preclinical models is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Last reviewed on 2026-01-19. Where a claim depends on a specific study, the study is described rather than over-claimed.
Regulatory treatment varies, but cardarine is not approved as a medicine. Sports authorities list GW501516 as a prohibited substance, and it is banned at all times under the World Anti-Doping Agency code. Many countries restrict sales for human consumption, while online vendors market it as a research chemical. Such products may lack purity data, and their actual contents can differ from the label. Purchasing or possessing cardarine may carry legal consequences depending on jurisdiction. The compound is not a dietary supplement ingredient in regulated markets.
Clinical development stopped after rodent studies showed tumors at multiple sites. Whether those findings predict human cancer risk remains an open question, but they led sponsors to discontinue programs. Human safety data are limited to small, short-term studies that were not designed to assess cancer risk. Reported effects in those studies included changes in blood lipids, but the evidence is insufficient for medical use. Long-term consequences of nonmedical use are not well characterized. Questions about dose, duration, and individual susceptibility remain unresolved.
Cardarine is a common name for GW501516, an investigational compound developed in the 1990s for metabolic conditions. It acts as an agonist at peroxisome proliferator-activated receptor delta, a nuclear receptor involved in lipid and energy metabolism. The compound is frequently mislabeled as a selective androgen receptor modulator, or SARM, but its molecular target is different. GW501516 reached early clinical testing before development was discontinued. It has no approved therapeutic use in any country. The name cardarine is not a formal international nonproprietary name.
Handling and quality assessment of cardarine reference material follow general laboratory practices for poorly characterized compounds. It typically appears as a white to off-white powder and is sparingly soluble in water but soluble in organic solvents such as dimethyl sulfoxide and ethanol. Storage recommendations usually specify a cool, dry, dark place, with long-term storage at low temperature and desiccation. Purity may be checked by high-performance liquid chromatography with ultraviolet detection, while identity is confirmed by mass spectrometry and nuclear magnetic resonance. No pharmacopeial monograph exists, so reported purity and stability depend on the supplier’s methods.
GW501516 acts as a selective agonist at PPARδ, a nuclear receptor that regulates transcription of genes involved in lipid handling and energy metabolism. Activation of PPARδ in preclinical models increases fatty acid oxidation, mitochondrial biogenesis, and exercise endurance in rodents. These effects have made the compound a subject of metabolic research and also a target for sport anti-doping rules. In humans, however, controlled studies are limited, and whether similar endurance or metabolic changes occur at tolerated exposures remains an open question. The receptor’s broad tissue distribution also means downstream effects may vary by organ and condition.
| Property | Value | Notes |
|---|---|---|
| Common synonyms | GW501516; GW-1516; endurobol | GW501516 is the research code |
| Drug class | PPARδ agonist | Not a selective androgen receptor modulator |
| Molecular formula | C21H18F3NO3S2 | Established chemical formula |
| Molar mass | 453.5 g/mol | Calculated from the formula |
| Regulatory status | Prohibited in sport; not approved as medicine | Status varies by country |
In the fitness and bodybuilding literature, cardarine is frequently discussed as an endurance agent or fat-loss compound, although such claims are not supported by robust clinical evidence. Online descriptions often mix animal data, user anecdotes, and marketing language. Researchers who study PPARδ agonists distinguish between receptor activation in controlled experiments and unsupervised use of unverified products. The latter introduces unknown purity, dose, and interactions, making reported experiences difficult to interpret scientifically.
GW501516 acts as an agonist at peroxisome proliferator-activated receptor delta, a nuclear receptor involved in transcription of genes related to lipid handling and energy use. Activation of PPARδ can shift skeletal muscle toward greater fatty acid oxidation in animal models, which is one reason it drew interest for metabolic disease and exercise research. The exact downstream effects depend on tissue, species, dose, and duration. Human data are sparse, so many proposed benefits remain hypotheses rather than established clinical outcomes.
Cardarine is frequently described as a fat-burning or endurance-enhancing supplement, but these claims exceed the available evidence. The compound is not a hormone, steroid, or selective androgen receptor modulator. Research articles discuss it as a tool compound for studying PPARδ biology, while anti-doping literature focuses on its abuse and detection. Quality of unapproved products is uncertain, and independent analyses have found impurities or incorrect labeling. Open questions include whether human cancer risk resembles that seen in rodents and how often non-athletes use the substance.
Cardarine has no approved therapeutic indication and is not marketed as a medicine. The World Anti-Doping Agency lists GW501516 as a prohibited substance at all times, covering both in-competition and out-of-competition periods. National laws vary: some countries treat it as an unapproved drug subject to import controls, while others have specific restrictions on sale for human consumption. It is often sold as a research chemical, a label that does not imply safety or legality. Enforcement actions have targeted online vendors and shipments.
Anti-doping laboratories identify GW501516 and related metabolites using liquid chromatography coupled with tandem mass spectrometry. Urine is the most common matrix, though blood and dried blood spots may also be analyzed. The method targets the parent compound and phase I and phase II metabolites, which extend the detection window. Because the substance is prohibited at all times, athletes can be tested outside competition. Detection limits and windows depend on the assay, sample type, and individual metabolism.
A persistent misconception is that cardarine is a fat-burning drug or a safe alternative to anabolic steroids. No approved therapeutic product exists, and human safety data are limited. The tumor findings in rodents remain a central concern in scientific reviews. Products sold online may contain inaccurate labels, impurities, or different compounds entirely, which complicates any assessment of effects. Independent testing of such products has reported frequent mislabeling. For these reasons, discussions in the literature emphasize risks and unknowns rather than benefits.
Cardarine is not approved for human therapeutic use in any major jurisdiction. It appears on the World Anti-Doping Agency Prohibited List as a PPARδ agonist within the hormone and metabolic modulators category. Sports organizations test for it because it has been detected in athlete samples and seized products. Regulatory actions against marketed research chemical versions have occurred in several countries, though enforcement varies. Availability through unregulated channels complicates oversight.
Analytical laboratories typically identify cardarine and its metabolites using liquid chromatography-tandem mass spectrometry. Urine is a common matrix in anti-doping testing, while blood and tissue may be used in research settings. Detection windows depend on the assay, the sample matrix, and the compound's metabolism. Because cardarine is extensively metabolized, laboratories often target specific metabolites to improve sensitivity and confirmation. Reference standards are required for reliable quantification. Method validation includes checks for selectivity, linearity, and carryover.
In laboratory settings, cardarine is studied as a tool compound for probing PPARδ biology. Published experiments often use cell cultures, rodent models, or isolated tissues. Some investigations focus on metabolic effects, while others assess potential risks such as carcinogenicity observed in long-term animal studies. Because human trials are sparse, most knowledge comes from preclinical work and adverse event reports. Scientific literature frequently notes the gap between animal findings and human outcomes. The compound is not a dietary supplement and is not intended for human consumption.
Cardarine is a common name for GW501516, a synthetic compound developed in the 1990s through research collaborations involving GlaxoSmithKline. It belongs to a class of molecules known as peroxisome proliferator-activated receptor delta agonists. Early studies explored its effects on lipid metabolism and energy expenditure in animal models. The compound was never approved as a human medicine, and clinical development was discontinued. In the years since, it has appeared in fitness and bodybuilding communities as a performance-enhancing substance. Regulatory agencies classify it as an unapproved drug.
PPARδ is a nuclear receptor that regulates gene expression related to fatty acid oxidation, glucose homeostasis, and mitochondrial function. GW501516 binds to this receptor with high affinity and activates downstream signaling in skeletal muscle and other tissues. Animal studies reported increased endurance and altered fuel preference, but human data remain limited and inconsistent. The precise relationship between receptor activation and observed physiological changes is still an area of active investigation. Researchers have also examined whether the compound affects inflammation or cell proliferation. No approved therapeutic indication exists for cardarine.
The American Society for Biochemistry and Molecular Biology (ASBMB) is a learned society that was founded on December 26, 1906, at a meeting organized by John Jacob Abel (Johns Hopkins University). The roots of the society were in the American Physiological Society, which had been formed some 20 years earlier. ASBMB is the US member of the International Union of Biochemistry and Molecular Biology. The ASBMB was originally called the American Society of Biological Chemists, before obtaining its current name in 1987. The society is based in Rockville, Maryland. ASBMB's mission is to advance the science of biochemistry and molecular biology through publication of scientific and educational journals, the organization of scientific meetings, advocacy for funding of basic research and education, support of science education at all levels, and by promoting the diversity of individuals entering the scientific workforce. The organization currently has over 12,000 members.
== Early life and education == Todd was born on December 4, 1954, in Washington, D.C., the son of Evetta Lyons Gaither. He grew up in Hartford, Connecticut, attending local schools including Hartford Public High School. He was also an alumnus of the Artists Collective, Inc. Todd attended the University of Connecticut and then went on to study theater at the Tony Award-winning Eugene O'Neill National Actors Theatre Institute, and the Trinity Repertory Company in Providence, Rhode Island. Tony has one living brother and a sister.
== Production == Most 131I production is from neutron irradiation of a natural tellurium target in a nuclear reactor. Irradiation of natural tellurium produces almost entirely 131I as the only radionuclide with a half-life longer than hours (and shorter than millions of years), since lighter isotopes of tellurium become heavier stable isotopes, or else stable antimony or iodine. However, the heaviest naturally occurring tellurium nuclide, 130Te (34% of natural tellurium) absorbs a neutron to become tellurium-131, which beta decays with a half-life of 25 minutes to 131I. A tellurium compound can be irradiated while bound as an oxide to an ion exchange column, with evolved 131I then eluted into an alkaline solution. More commonly, powdered elemental tellurium is irradiated and then 131I separated from it by dry distillation of the iodine, which has a far higher vapor pressure. The element is then dissolved in a mildly alkaline solution in the standard manner, to produce 131I as iodide and hypoiodate (which is soon reduced to iodide). 131I is a fission product with a yield of 2.878% from uranium-235, and can be released in nuclear weapons tests and nuclear accidents. However, the short half-life means it is not present in significant quantities in cooled spent nuclear fuel, unlike iodine-129 whose half-life is nearly a billion times that of 131I. It is discharged to the atmosphere in small quantities by some nuclear power plants.
The largest and most famous sphinx is the Great Sphinx of Giza, situated on the Giza Plateau adjacent to the Great Pyramids of Giza on the west bank of the Nile River and facing east (29°58′31″N 31°08′15″E). The sphinx is located southeast of the pyramids. While the date of its construction is not known for certain, the consensus among Egyptologists is that the head of the Great Sphinx bears the likeness of the pharaoh Khafre, dating it to between 2600 and 2500 BC. However, a fringe minority of late 20th century geologists have claimed evidence of water erosion in and around the Sphinx enclosure which would prove that the Sphinx predates Khafre, at around 10,000 to 5000 BC, a claim that is sometimes referred to as the Sphinx water erosion hypothesis but which has little support among Egyptologists and contradicts other evidence. What names their builders gave to these statues is unknown. At the Great Sphinx site, a 1400 BC inscription on a stele belonging to the 18th dynasty pharaoh Thutmose IV lists the names of three aspects of the local sun deity of that period, Khepera–Rê–Atum. Many pharaohs had their heads carved atop the guardian statues for their tombs to show their close relationship with the powerful solar deity Sekhmet, a lioness. Besides the Great Sphinx, other famous Egyptian sphinxes include one bearing the head of the pharaoh Hatshepsut, with her likeness carved in granite, which is now in the Metropolitan Museum of Art in New York, and the alabaster Sphinx of Memphis, currently located within the open-air museum at that site.
As a decentralized system, bitcoin operates without a central authority or single administrator, so that anyone can create a new bitcoin address and transact without needing any approval. This is accomplished through a specialized distributed ledger called a blockchain that records bitcoin transactions. The blockchain is implemented as an ordered list of blocks. Each block contains the hash of the previous block, made by hashing its header twice with SHA-256, chaining them in chronological order. The blockchain is maintained by a peer-to-peer network. Individual blocks, public addresses, and transactions within blocks are public information, and can be examined using a blockchain explorer. Nodes validate and broadcast transactions. Each node maintains a copy of the blockchain for ownership verification. A new block is created every 10 minutes on average, updating the blockchain across all nodes without central oversight. This process tracks bitcoin spending, ensuring each bitcoin is spent only once. Unlike a traditional ledger that tracks physical currency, bitcoins exist digitally as unspent outputs of transactions.
Sources: en.wikipedia.org
With both P-selectin and ICAM-1 on the substrate, cells attached and rolled, but the presence of ICAM-1 had no effect. However, if a neutrophil chemoattractant was added to the flow stream, it activated GPCR signaling, actin polymerization, and integrin-dependent firm adhesion to ICAM-1. Springer integrated these findings into the “three step paradigm” of leukocyte extravasation (diapedesis), which has become the standard framework for understanding leukocyte trafficking in inflammation. The laboratory of Eugene Butcher, including postdoctoral fellow Uli von Andrian, was working on emigration of leukocytes in vivo at the same time, and discovered that antibody to leukocyte integrins inhibited firm adhesion, but not rolling adhesion, to postcapillary venules at sites of inflammation. Butcher and Springer received the 2004 Crafoord Prize for this work. Springer's paradigm that integrins on leukocytes bind to counter-receptors with Ig-like domains on endothelium was later extended by others to integrin α4β1 binding to vascular cell adhesion molecule-1 (VCAM-1), which is inducible by inflammatory mediators on endothelium, and α4β7 binding to mucosal addressin cell adhesion molecule-1 (MAdCAM-1), which is constitutively expressed on mucosal endothelium. At the time that Springer described the three step model, no chemoattractants for peripheral blood lymphocytes that could stimulate emigration were known. Their existence was implied by the ability of pertussis toxin, which modifies the G protein Gαi subunit, to cause lymphocytosis in patients with whooping cough.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Profilin was first described by Lars Carlsson in the lab of Uno Lindberg and co-workers in the early 1970s as the first actin monomer binding protein. It followed the realization that not only muscle, but also non-muscle cells, contained high concentrations of actin, albeit in part in an unpolymerized form. Profilin was then believed to sequester actin monomers (keep them in a pro-filamentous form), and release them upon a signal to make them accessible for fast actin polymer growth.
D-Ribose-L-cysteine was developed by Herbert T. Nagasawa, a medicinal chemist formerly affiliated with the United States Department of Veterans Affairs and the University of Minnesota, whose research focused on sulfur amino acid metabolism and hepatic toxicology. The compound and its use as a glutathione-enhancing agent are protected by multiple patents, including United States Patent US 9,173,917 B2, assigned to Max International and the U.S. Department of Veterans Affairs. D-Ribose-L-cysteine has since been incorporated into dietary supplement formulations marketed by Max International, Inc. and LiveMax, LLC.
The probable chemistry of roentgenium has received more interest than that of the two previous elements, meitnerium and darmstadtium, as the valence s-subshells of the group 11 elements are expected to be relativistically contracted most strongly at roentgenium. Calculations on the molecular compound RgH show that relativistic effects double the strength of the roentgenium–hydrogen bond, even though spin–orbit interactions also weaken it by 0.7 eV (68 kJ/mol). The compounds AuX and RgX, where X = F, Cl, Br, O, Au, or Rg, were also studied. Rg+ is predicted to be the softest metal ion, even softer than Au+, although there is disagreement on whether it would behave as an acid or a base. In aqueous solution, Rg+ would form the aqua ion [Rg(H2O)2]+, with an Rg–O bond distance of 207.1 pm. It is also expected to form Rg(I) complexes with ammonia, phosphine, and hydrogen sulfide.
Sources: en.wikipedia.org
No. Cardarine is GW501516, a PPARδ agonist, while SARMs act on androgen receptors. The two classes are often grouped in informal discussions despite different mechanisms.
No. It has no approved medical indication in any country. Regulatory agencies have not cleared it for treatment or prevention of any condition.
Early clinical work stopped after rodent carcinogenicity findings. Those animal results raised concerns about long-term human risk, although direct human evidence is lacking. The human relevance of the tumors remains an open scientific question.
Cardarine targets PPARδ, a nuclear receptor involved in lipid and energy metabolism. It does not bind the androgen receptor in the way SARMs do.