PPARδ comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Updated 2026-03-30. Numbers and descriptions here follow the published literature rather than marketing material.
Laboratory handling focuses on identity, purity, and stability. Reference standards are typically stored cold and dry, protected from light, because solutions can degrade over time. Analytical checks may use high-performance liquid chromatography with ultraviolet detection or mass spectrometry. Impurities and related substances can be separated chromatographically and compared with a known standard. Because cardarine is not an approved drug, compendial monographs are absent, and laboratories often rely on in-house methods. Reported purity varies among unregulated products and should not be assumed from a label.
GW501516 binds and activates PPARδ, a nuclear receptor that influences transcription of genes involved in fatty acid oxidation and energy use. Activation shifts some metabolic pathways in preclinical models, which is why the compound has been studied for lipid disorders and exercise-related endpoints. The exact downstream effects in humans are incompletely mapped. PPARδ is expressed in many tissues, including skeletal muscle, liver, and adipose tissue, so broad activation may have varied consequences. Researchers continue to examine how selective or partial activation might alter the balance between benefits and risks.
Published human data are sparse and mostly come from early-phase trials. Those studies examined short-term changes in lipids, glucose, and exercise capacity, but they were not large enough to establish efficacy or long-term safety. Some animal experiments reported increased running endurance, yet such findings do not prove a performance benefit in people. Anti-doping laboratories detect GW501516 and its metabolites in urine or blood using liquid chromatography-tandem mass spectrometry. Detection windows depend on dose, sample type, and individual metabolism. The method is sensitive enough to identify trace residues in tested samples.
At the molecular level, GW501516 binds and activates PPARδ, a nuclear receptor that regulates transcription. Activation shifts expression of genes involved in fatty acid oxidation, energy expenditure, and lipid transport in skeletal muscle and liver. Animal studies report increased endurance and altered lipid profiles after exposure. Human data are limited to small trials and do not establish long-term safety or efficacy. PPARδ also has roles in cell proliferation, so the relationship between activation and cancer risk remains an open question.
Published literature on cardarine includes in vitro assays, rodent experiments, and a small number of human studies. Reports describe effects on exercise capacity and lipid metabolism in animals, while human evidence is sparse. Many online descriptions present the compound as a proven endurance aid, a claim not supported by regulatory approval or large clinical trials. Analytical studies focus on identifying the parent compound and its metabolites in biological samples. Important uncertainties include species differences, dose-response relationships, and the relevance of rodent tumor findings to humans.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white solid | Typical form of reference material |
| Solubility | Low in water; soluble in DMSO | Used to prepare stock solutions |
| Typical storage | -20 °C, desiccated, protected from light | Common laboratory practice |
| Analytical method | LC-MS/MS | Detects parent compound and metabolites |
| Common test matrix | Urine or blood | Used in anti-doping analysis |
Products sold as cardarine have been found to contain incorrect compounds, variable amounts, or no active ingredient at all. Independent testing is required to verify identity and purity. Common analytical approaches include high-performance liquid chromatography, mass spectrometry, and nuclear magnetic resonance for structural confirmation. These methods can distinguish GW501516 from related PPAR agonists and from unrelated steroids. For regulators and researchers, such verification is central to interpreting both biological results and adverse event reports.
Cardarine is prohibited in competitive sport under the World Anti-Doping Agency code, where it is classified as a metabolic modulator. It is not approved as a prescription medicine in the United States, European Union, or other major markets. Regulatory action has focused on its presence in sports and in products marketed as research chemicals. Because it has no accepted medical indication, supply is often unregulated. This status creates legal and safety uncertainties for anyone who encounters the substance.
Analytical laboratories typically identify cardarine and its metabolites using liquid chromatography-tandem mass spectrometry. Urine is a common matrix in anti-doping testing, while blood and tissue may be used in research settings. Detection windows depend on the assay, the sample matrix, and the compound's metabolism. Because cardarine is extensively metabolized, laboratories often target specific metabolites to improve sensitivity and confirmation. Reference standards are required for reliable quantification. Method validation includes checks for selectivity, linearity, and carryover.
A persistent misconception is that cardarine is a fat-burning drug or a safe alternative to anabolic steroids. No approved therapeutic product exists, and human safety data are limited. The tumor findings in rodents remain a central concern in scientific reviews. Products sold online may contain inaccurate labels, impurities, or different compounds entirely, which complicates any assessment of effects. Independent testing of such products has reported frequent mislabeling. For these reasons, discussions in the literature emphasize risks and unknowns rather than benefits.
In January 1949, President Truman, responding to advice from staff who had worked with IIAA, proposed a globalized version of the program as the fourth element of his overall foreign policy – "Point IV". The purpose of the program was to provide technical knowledge to aid the growth of underdeveloped countries around the world. After a lengthy debate, Congress approved the Point Four Program in 1950 and the Technical Cooperation Administration (TCA) was established within the Department of State in September 1950 to administer it. After an initial attempt to operate in the mode of the old Interdepartmental Committee and to merely coordinate programs of other agencies (such as IIAA), TCA adopted an integrated implementation mechanism in November 1951. In an approach that was greatly expanded after 1953, some early technical assistance projects were implemented by U.S. universities under contract to TCA. University project staff in some cases helped perform administrative functions in TCA missions that were in the process of being set up.
== Side effects == Rupatadine is a non-sedating antihistamine. However, as in other non sedating second-generation antihistamines, the most common side effects in controlled clinical studies were somnolence, headaches and fatigue.
With the exception of Russia, the Polish nation has the distinction among other Slavic peoples of having enjoyed independence as a part of various entities for several centuries prior to the advent of Pan-Slavism. After 1795, Revolutionary and Napoleonic France had influenced many Poles who sought the reconstitution of their existing country—particularly since France was a mutual enemy of Austria, Prussia, and also Russia. Russia's Pan-Slavic rhetoric had alarmed the Poles. Pan-Slavism was not fully embraced among Poles after the early period. Poland did nevertheless express solidarity with those of its fellow Slavic nations that had suffered oppression and were seeking independence. While Pan-Slavism as an ideology was inimical to Austro-Hungarian interests, Poles instead embraced the wide autonomy within the state and assumed a loyalist position towards the Habsburgs. Within the Austro-Hungarian polity, they were able to develop their national culture and preserve the Polish language, both of which were under threat in both German and Russian Empires. A Pan-Slavic federation was proposed, but on the condition that the Russian Empire would be excluded from such an entity. After Poland regained its independence (from Germany, Austria and Russia) in 1918, no internal faction considered Pan-Slavism as a serious alternative, viewing Pan-Slavism as Russification. During Poland's communist era, the USSR used Pan-Slavism as a propaganda tool to justify its control over the country.
=== Routes of administration === Doxycycline can be administered orally or intravenously. The combination of doxycycline with dairy, antacids, calcium supplements, iron products, laxatives containing magnesium, or bile acid sequestrants may decrease absorption of doxycycline, though these interactions are not inherently dangerous. Doxycycline has a high oral bioavailability, as it is almost completely absorbed in the stomach and proximal small intestine. Unlike older tetracyclines, whose absorption is substantially reduced by food, doxycycline absorption is only modestly affected: co-administration of dairy products reduces the serum concentration of doxycycline by about 20%, compared with a 50% reduction for tetracycline. Doxycycline absorption is inhibited by cations with a 2+ or 3+ charge (divalent and trivalent cations), such as iron, bismuth, aluminum, calcium, and magnesium. Doxycycline forms unstable complexes with these metal ions in the acidic environment of the stomach; most of these complexes dissociate in the small intestine, allowing the drug to be absorbed. However, some doxycycline remains complexed with metal ions in the duodenum, resulting in a slight decrease in absorption.
Sources: en.wikipedia.org
Note: In 2008, WOSM's conference decided that, starting at the conference in 2011, elected committee members will serve for only three years but be eligible for re-election for one additional term. Due to the COVID-19 pandemic, WOSM's conference was rescheduled from Aug 2020 to Aug 2021.
Aquaculture topic page from Woods Hole Oceanographic Institution "Aquaculture Factsheet". Waitt Institute. 4 June 2015. Archived from the original on 2015-06-17. Retrieved 2015-06-08. The Coastal Resources Center NOAA aquaculture The University of Hawaiʻi's AquacultureHub
HN MAPRGESCLLLLTSEIDLPVKRRA S1 MCHWAGGASNTGDARGDVFGKQAG S2 MGVKFFTLSTREFPSVQRAVPLWTNS S3 MLGYNFSSFPCGTISIAPGENFYRLYFIWVNGLAKVVW S4 MLEVMELVNRRGKICRVPETFFNLSL S5 MYCSEVGFCSEVAPTEIFNAGLWV S6 MLDQDIPMVQPLLKVRLEND
Achondroplasia (dwarfism) Anaplasia (structural differentiation loss within a cell or group of cells) Aplasia (organ or part of organ missing) Desmoplasia (connective tissue growth) Dysplasia (change in cell or tissue phenotype) Hyperplasia (proliferation of cells) Hypoplasia (congenital below-average number of cells, especially when inadequate) Metaplasia (conversion in cell type) Neoplasia (abnormal proliferation) Prosoplasia (development of new cell function) The suffix trophy refers to the nourishment and development of cells, tissue, and organs, coming from Greek τροφή (trophḗ), food, nourishment.
== Interactions == Collagen, type VII, alpha 1 forms a complex network with several other proteins in the basement membrane. It has been shown to interact with laminin 5 and fibronectin, as well as collagen IV, by binding these proteins in the NC-1 domain. The stability of the basement membrane and dermal-epidermal junction is thought to be due to these interactions.
Sources: en.wikipedia.org
== Uses == Although edible and choice, this mushroom is not commercially cultivated on account of its fast maturing and short shelf life. Care is needed to distinguish it from poisonous species. There have been cases (notably in France) in which the deadly Amanita virosa was consumed by individuals who mistook it for this species. Additionally, specimens collected from lawns could be contaminated by pesticides or other chemicals. Culinary uses include eating it sauteed or fried, in sauces, or even sliced raw and included in salads. In flavor and texture, this mushroom is similar to the white button mushroom (A. bisporus) available in grocery stores in most Western countries.
=== Silicon batteries === The company started promoting its silicon-graphite-electrode batteries in 2019 and ceased development of its germanium-based batteries in 2020. The company sent germanium sample batteries to manufacturers in place of silicon sample batteries. The company's CEO said the germanium batteries were only developed as proof-of-concept, were only meant to be sold in small quantities, and that they were never released because they weren't sufficiently differentiated from the rest of the market. Group14 Technologies has developed silicon nanoparticles called SCC55 which allow lithium-silicon batteries to charge from 10% to 80% state-of-charge in 10 minutes. StoreDot tested the material for use in their silicon batteries. The company was looking in 2023 for suppliers capable of manufacturing thousands of tonnes of this material, which is critical for their business. The battery cells have a sponge-like carbon electrode imbued with silicon nanoparticles that react with the lithium ions, keeping the silicon's expansion within the carbon "sponge".
The Boston keratoprosthesis is the most widely used synthetic cornea to date with over 900 procedures performed worldwide in 2008. The Boston KPro was developed at the Massachusetts Eye and Ear Infirmary under the leadership of Claes Dohlman.
CYB5R1, NADH-cytochrome b5 reductase 1, located on chromosome 1q32.1 with 9 exons that encode for c5br. CYB5R2, NADH-cytochrome b5 reductase 2, located on chromosome 11p15.4 with 12 exons that encode for c5br. CYB5R3, NADH-cytochrome b5 reductase 3, located on chromosome 22q13.2 with 12 exons that encode for c5br. CYB5R4, NADH-cytochrome b5 reductase 4, located on chromosome 6q14.2 with 16 exons that encode for c5br. Mutations in cytochrome b5 reductase can lead to many disorders, including autosomal recessive congenital methemoglobinemia. There are over 65 mutations of the enzyme that can lead to various types of the disorder. Some include:
Sources: en.wikipedia.org
Anti-doping and clinical laboratories commonly use liquid chromatography-tandem mass spectrometry. The method can identify GW501516 and its metabolites in urine or blood. Detection depends on sample timing and the amount present.
PPARδ is a nuclear receptor that regulates genes linked to fatty acid oxidation and energy metabolism. Activation can alter lipid handling and energy use in experimental models. The full range of effects in humans is still under study.
The solid compound is generally stable when kept cold, dry, and protected from light. Solutions may degrade faster, so laboratory protocols often specify fresh preparation or cold storage. Stability can depend on solvent, concentration, and container.
Cardarine is a common name for the investigational compound GW501516. It acts as a PPARδ agonist and is not approved for human use. It is prohibited in sport.