This is a working overview of Nuclear receptor, written for readers who want more than a one-paragraph summary but less than a textbook.
Reviewed 2026-05-25. Anything still debated is marked as such rather than presented as settled.
Quality assessment for cardarine samples usually combines identity, purity, and impurity testing. Nuclear magnetic resonance spectroscopy and mass spectrometry can confirm molecular structure, while high-performance liquid chromatography estimates purity. Certificates of analysis from testing laboratories may list these results, but they do not establish safety or legality. In the absence of approved manufacturing, products sold online may contain the wrong compound, variable amounts, or unlisted contaminants. Independent verification is therefore central to analytical work and to interpreting any reported biological activity.
Laboratory detection of GW501516 commonly uses liquid chromatography coupled with tandem mass spectrometry. The method can identify the parent compound or its metabolites in urine and blood after sample cleanup. Protein precipitation, solid-phase extraction, or enzymatic hydrolysis may precede analysis, depending on the matrix. Reference standards are required for accurate quantification and confirmation. Because the compound is not approved, testing often occurs in anti-doping, forensic, or research settings rather than routine clinical care. Results are reported with limits of detection and quantification.
Stability of GW501516 depends on form, temperature, light exposure, and moisture. Solid reference material is typically stored frozen or refrigerated in a desiccator and protected from light. Solutions in organic solvents such as dimethyl sulfoxide are often kept frozen in aliquots to reduce freeze-thaw cycling. Aqueous solubility is low, so aqueous stock solutions can be difficult to prepare without cosolvents. Degradation may appear as changes in chromatographic purity or mass spectral signal. Stability studies are needed to establish shelf life for any specific preparation.
Literature on cardarine often separates receptor pharmacology from toxicology. Mechanistic papers describe PPARδ activation and gene expression changes, while safety assessments focus on carcinogenicity and species differences. Questions remain about whether rodent tumors arise through PPARδ-dependent or off-target mechanisms. Another open area is how human metabolism and exposure compare with those in animal studies. Analytical methods such as liquid chromatography–mass spectrometry are used to confirm identity in biological and product samples.
GW501516 acts as an agonist at the peroxisome proliferator-activated receptor delta, a nuclear receptor that regulates gene expression. Activation shifts transcription toward genes involved in fatty acid uptake, oxidation, and energy expenditure. The compound does not bind the androgen receptor and therefore differs from anabolic steroids and SARMs. In rodent models, this metabolic shift has been linked to increased running endurance and reduced fat accumulation. The exact downstream pathways in humans remain incompletely characterized.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Common for reference-grade material. |
| Solubility | Low in water | Dissolves in DMSO and some organic solvents. |
| Typical storage | -20 °C, desiccated | Protect from light and moisture. |
| Analytical method | LC-MS/MS | Used for trace detection in biological matrices. |
| Purity assessment | HPLC with UV detection | Often combined with NMR and mass spectrometry. |
Clinical development stopped after rodent studies showed tumors at multiple sites. Whether those findings predict human cancer risk remains an open question, but they led sponsors to discontinue programs. Human safety data are limited to small, short-term studies that were not designed to assess cancer risk. Reported effects in those studies included changes in blood lipids, but the evidence is insufficient for medical use. Long-term consequences of nonmedical use are not well characterized. Questions about dose, duration, and individual susceptibility remain unresolved.
Cardarine is a common name for GW501516, an investigational compound developed in the 1990s for metabolic conditions. It acts as an agonist at peroxisome proliferator-activated receptor delta, a nuclear receptor involved in lipid and energy metabolism. The compound is frequently mislabeled as a selective androgen receptor modulator, or SARM, but its molecular target is different. GW501516 reached early clinical testing before development was discontinued. It has no approved therapeutic use in any country. The name cardarine is not a formal international nonproprietary name.
Regulatory treatment varies, but cardarine is not approved as a medicine. Sports authorities list GW501516 as a prohibited substance, and it is banned at all times under the World Anti-Doping Agency code. Many countries restrict sales for human consumption, while online vendors market it as a research chemical. Such products may lack purity data, and their actual contents can differ from the label. Purchasing or possessing cardarine may carry legal consequences depending on jurisdiction. The compound is not a dietary supplement ingredient in regulated markets.
The compound is typically described as a laboratory compound rather than a therapeutic product. Published reports have explored its role in lipid disorders, insulin sensitivity, and exercise metabolism, yet no major drug regulator has approved it for medical use. Commercial samples sold under the cardarine name may vary in purity and identity. Analytical confirmation is therefore necessary when the material is discussed in scientific or regulatory contexts. Its classification as a prohibited substance in sport further shapes how it is studied and reported.
Cardarine is a common name for GW501516, a synthetic compound studied for its effects on lipid and glucose metabolism. It functions as an agonist at peroxisome proliferator-activated receptor delta, or PPARδ, a nuclear receptor that influences gene expression. The molecule is not a steroid, nor is it a selective androgen receptor modulator. It is also known in research and sports literature as GW-501516 and endurobol. Early laboratory work examined its metabolic activity in cell cultures and animal models.
Activation of PPARδ changes transcription of genes involved in fatty acid transport, mitochondrial function, and skeletal muscle fuel preference. In rodent studies, pharmacological PPARδ activation was associated with increased endurance and altered body composition. These findings generated interest in performance enhancement, but species differences and study designs limit direct extrapolation to humans. Small human trials were conducted in the 2000s and later discontinued. The extent to which cardarine produces similar metabolic or performance effects in people remains an open question.
Though BMI is often used to help assess for excess weight, it is not a perfect representation of a person's body fat percentage. For example, an individual can have a higher than normal BMI but a normal body fat percentage if they have higher than average muscle mass. This is because excess muscle contributes to a higher weight. Since BMI is not a perfect representation of a person's body fat percentage, other measurements like waist circumference are often used to better assess for unhealthy excess weight. The following table shows how different ranges of BMIs are often categorized into underweight, normal weight, overweight, and obese:
1904: American geographer, geologist and educator Zonia Baber published her article "The Scope of Geography", in which she laid out her educational theories on the teaching of geography. She argued that students required a more interdisciplinary, experiential approach to learning geography: instead of a reliance on textbooks, students needed field-trips, lab work and map-making knowledge. Baber's educational ideas transformed the way schools taught geography. 1904: British chemists Ida Smedley, Ida Freund and Martha Whiteley organized a petition asking the Chemical Society to admit women as Fellows. A total of 19 female chemists became signatories, but their petition was denied by the society. 1904: Marie Stopes was a British author, palaeobotanist and campaigner for women's rights. She made significant contributions to plant palaeontology and coal classification. She held the post of Lecturer in Palaeobotany at the University of Manchester from 1904 to 1910; in this capacity she became the first female academic of that university. In 1909, she was elected to the Linnean Society of London. She was 26 at the time of her election to Fellowship (the youngest woman admitted at that time). 1904: In a December meeting, the Linnean Society of London elected its first women Fellows. These initial women included horticulturalist Ellen Willmott, ornithologist Emma Turner, biologist Lilian Jane Gould, mycologists Gulielma Lister and Annie Lorrain Smith, and botanists Mary Anne Stebbing, Margaret Jane Benson and Ethel Sargant.
The 17-bp transcriptional complex has an 8-bp DNA-RNA hybrid, that is, 8 base-pairs involve the RNA transcript bound to the DNA template strand. As transcription progresses, ribonucleotides are added to the 3′ end of the RNA transcript and the RNAP complex moves along the DNA. The characteristic elongation rates in prokaryotes and eukaryotes are about 10–100 nts/sec. Aspartyl (asp) residues in the RNAP will hold on to Mg2+ ions, which will, in turn, coordinate the phosphates of the ribonucleotides. The first Mg2+ will hold on to the α-phosphate of the NTP to be added. This allows the nucleophilic attack of the 3′-OH from the RNA transcript, adding another NTP to the chain. The second Mg2+ will hold on to the pyrophosphate of the NTP. The overall reaction equation is:
The top-down approach is breaking down of a system into small components, while bottom-up is assembling sub-systems into a larger system. A bottom-up approach for nano-assembly is a primary research target for nano-fabrication because top down synthesis is expensive (requiring external work) and is not selective on very small length scales, but is currently the primary mode of industrial fabrication. Generally, the maximum resolution of the top-down products is much coarser than those of bottom-up; therefore, an accessible strategy to bridge "bottom-up" and "top-down", is realizable by the principles of self-assembly. By controlling local intermolecular forces to find the lowest-energy configuration, self-assembly can be guided by templates to generate similar structures to those currently fabricated by top-down approaches. This so-called bridging will enable fabrication of materials with the fine resolution of bottom-up methods and the larger range and arbitrary structure of top-down processes. Furthermore, in some cases components are too small for top-down synthesis, so self-assembly principles are required to realize these novel structures. Classification Nanostructures can be organized into groups based on their size, function, and structure; this organization is useful to define the potential of the field. By size Among the more sophisticated and structurally complex nanostructures currently available are organic macromolecules, wherein their assembly relies on the placement of atoms into molecular or extended structures with atomic-level precision.
Lepirudin is an anticoagulant that functions as a direct thrombin inhibitor. Brand name: Refludan, Generic: Lepirudin rDNA for injection. Lepirudin is a recombinant hirudin derived from yeast cells. Lepirudin is almost identical to hirudin extracted from Hirudo medicinalis, having the amino acid sequence LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ with disulfide bridges at Cys6-Cys14, Cys16-Cys28 and Cys22-Cys39, and differs from by the substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63. Lepirudin may be used as an anticoagulant when heparins (unfractionated or low-molecular-weight) are contraindicated because of heparin-induced thrombocytopenia.
Sources: en.wikipedia.org
initiation factor (IF) Any of various proteins which bind to the small or large subunit of ribosomes during the initiation of translation and thereby play roles in regulating when and how protein synthesis occurs. Initiation factors are essential for assembly of the initiation complex and for charged transfer RNAs to properly associate with the ribosome and the messenger RNA. They are frequent targets of activators and repressors which can respectively increase or decrease the rate of translation. Though their functions are largely conserved, they are distinguished by the taxonomic domain in which they occur: bacterial initiation factors (IFs), archaeal initiation factors (aIFs), and eukaryotic initiation factors (eIFs).
However, Ben Kiernan and Taylor Owen suggest that "the bombs drove ordinary Cambodians into the arms of the Khmer Rouge, a group that seemed initially to have slim prospects of revolutionary success." Kissinger himself defers to others on the subject of casualty estimates: "...since I am in no position to make an accurate estimate of my own, I consulted the OSD Historian, who gave me an estimate of 50,000 based on the tonnage of bombs delivered over the period of four and a half years." A number of Republican politicians complained to Nixon that his stance on Vietnam was hurting their chances for congressional elections in November 1970, leading the president to say to Kissinger it was natural that liberals like Senator George McGovern and Senator Mark Hatfield wanted to "bug out...But when the Right starts wanting to get out, for whatever reason, that's our problem". In an attempt to change Nixon's image, Kissinger and Nixon devised the notion of a "standstill cease-fire," where both sides would occupy whatever areas of South Vietnam they were holding at the time of the ceasefire, an offer that Nixon publicly made in a television address on 7 October 1970. In his speech, Nixon apparently moved away from the "mutual withdrawal formula" the North Vietnamese kept rejecting by not mentioning it, winning much acclaim, even from his opponents like McGovern and Hatfield (though he also said the withdrawal of U.S. forces would be "based on principles" he had "previously" discussed, i.e. the "mutual withdrawal formula").
After being treated with reagents, white blood cells form three distinct peaks when their volumes are plotted on a histogram. These peaks correspond roughly to populations of granulocytes, lymphocytes, and other mononuclear cells, allowing a three-part differential to be performed based on cell volume alone. More advanced analyzers use additional techniques to provide a five- to seven-part differential, such as light scattering or radiofrequency analysis, or using dyes to stain specific chemicals inside cells—for example, nucleic acids, which are found in higher concentrations in immature cells or myeloperoxidase, an enzyme found in cells of the myeloid lineage. Basophils may be counted in a separate channel where a reagent destroys other white cells and leaves basophils intact. The data collected from these measurements is analyzed and plotted on a scattergram, where it forms clusters that correlate with each white blood cell type. Another approach to automating the differential count is the use of digital microscopy software, which uses artificial intelligence to classify white blood cells from photomicrographs of the blood smear. The cell images are displayed to a human operator, who can manually re-classify the cells if necessary. Most analyzers take less than a minute to run all the tests in the complete blood count. Because analyzers sample and count many individual cells, the results are very precise.
Seizures Syndrome of inappropriate secretion of antidiuretic hormone Blood dyscrasias including: Agranulocytosis Thrombocytopenia Eosinophilia Leukopenia Myocardial infarction Heart block QTc interval prolongation Sudden cardiac death Depression worsening Suicidal ideation
=== Vaccines === The cold chain is used in the supply of vaccines to distant clinics in hot climates served by poorly developed transport networks. Disruption of a cold chain due to war or logistical challenges may produce severe consequences, as distributed vaccines can become inert due to a lack of temperature control during transport. The integrity of the vaccine cold chain is therefore a critical public health concern. For vaccines, there are different types of cold chains. There is an ultralow, or deep freeze, cold chain for vaccines that require -70 degrees C, such as the Ebola and Pfizer–BioNTech COVID-19 vaccines, and some animal vaccines. Next the frozen chain requires -20 degrees C. Varicella and zoster vaccinations require this level. Then the refrigerated chain, which requires temperatures between two and eight degrees C. Most flu vaccinations only require refrigeration. In 2020, during the COVID-19 pandemic, vaccines being developed may need ultracold storage and transportation temperatures as cold as −70 °C (−94 °F), requiring what has been referred to as a "colder chain" infrastructure. This creates some issues of distribution for the Pfizer vaccine. It is estimated that only 25 to 30 countries in the world have the infrastructure for the required ultracold cold chain.
Sources: en.wikipedia.org
At the same time, it has achieved drone sentiences and capability of Special Circumstance proportions in forms that could fit easily within a human hand, and built extremely powerful (though not sentient) computers capable of fitting into tiny insect-like drones. Some utilitarian devices (such as spacesuits) are also provided with artificial sentience. These specific types of drones, like all other Culture AI, would also be considered citizens – though as described in the short story "Descendant", they may spend most of the time when their "body" is not in use in a form of remote-linked existence outside of it, or in a form of AI-level virtual reality.
==== Rotary jet spinning ==== Rotary jet spinning is a technique used in the production of biotextiles, which involves the extrusion of polymer solutions or melts through a rapidly rotating spinneret. As the polymer solution or melt exits the spinneret, it is subjected to centrifugal forces, forming fine fibers. These fibers are collected to create a nonwoven fabric or scaffold structure suitable for various biomedical applications. Rotary jet spinning offers advantages such as producing highly porous structures with controllable fiber diameter and alignment, making it promising for tissue engineering and drug delivery applications in biomedicine.
Memphis International Airport (IATA: MEM, ICAO: KMEM, FAA LID: MEM), officially known as Frederick W. Smith International Airport, is a civil–military airport located seven miles (11 km; 6.1 nmi) southeast of downtown Memphis in Shelby County, Tennessee, United States. It is the primary airport serving Memphis. The airport covers 3,900 acres (1,600 ha) and has four runways. The airport is the "superhub" for FedEx Express, with the company operating nearly 400 flights per day from Memphis, mostly at night, to destinations including the continental United States, Canada, Europe, the Middle East, Asia, and South America. The airport averages about 80 passenger flights per day. The Memphis Air National Guard Base is located at the airport and houses the 164th Airlift Wing of the Tennessee Air National Guard, which operates C-17 Globemaster III transport aircraft. The airport opened in 1929. During World War II, it served as the base of the 4th Ferrying Group. A jet-age terminal opened in the 1960s. In 1973, Federal Express established its main hub at the airport. Memphis also served as a passenger hub from 1985 to 2013. Republic Airlines established the hub. After Republic merged with Northwest Airlines in 1986, Northwest continued to operate the hub. When Northwest subsequently merged with Delta Air Lines in 2008, it was considered redundant within Delta's network, and lost its hub status. The airport subsequently reduced its passenger facilities from three concourses to one. On August 11, 2026, the airport was renamed for Frederick W. Smith, founder of FedEx.
=== Insertion of transgenes === To integrate a gene fragment of interest into the Sendai virus genome, the following protocol might be used. The amplified gene fragment is inserted into a Sendai virus vector lacking the F protein (SeV/ΔF). The recovery and amplification of SeV/ΔF vectors proceed as follows: Transfection: 293T cells are transfected with the pSeV/ΔF template containing the transgene of interest, along with plasmids that encode the T7 RNA polymerase and the viral genes NP, P, F5R (a modified F protein), and L. Cultivation: Post-transfection, the cells are incubated and cultured for 1 to 3 days to produce the initial SeV/ΔF vector. Propagation: The vector is then propagated in LLC-MK2/F7/A cells, a specialized cell line of LLC-MK2 that expresses the Sendai virus F protein, in a medium that includes trypsin. Titer quantification: The titers of the harvested SeV vector are determined by measuring the cell infectious units (CIU) per milliliter through immunostaining with anti-SeV rabbit polyclonal serum.
Sprouting occurs at a rate of several millimeters per day, and enables new vessels to grow across gaps in the vasculature. It is markedly different from splitting angiogenesis because it forms entirely new vessels as opposed to splitting existing vessels.
Sources: en.wikipedia.org
LC-MS/MS is common, often after sample cleanup. The assay targets GW501516 or its metabolites.
Reference material is usually kept cold, dry, and protected from light. Frozen aliquots reduce repeated freeze-thaw cycles.
No approved pharmaceutical product exists, so manufacturing and quality controls are not standardized. Products may contain different compounds or impurities.
It targets PPARδ, a nuclear receptor involved in lipid and energy metabolism. It does not act primarily on androgen receptors. This distinction separates it from SARMs.