LC-MS/MS comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Updated 2025-10-31. Numbers and descriptions here follow the published literature rather than marketing material.
In laboratory settings, cardarine is studied as a tool compound for probing PPARδ biology. Published experiments often use cell cultures, rodent models, or isolated tissues. Some investigations focus on metabolic effects, while others assess potential risks such as carcinogenicity observed in long-term animal studies. Because human trials are sparse, most knowledge comes from preclinical work and adverse event reports. Scientific literature frequently notes the gap between animal findings and human outcomes. The compound is not a dietary supplement and is not intended for human consumption.
Cardarine is a common name for GW501516, a synthetic compound developed in the 1990s through research collaborations involving GlaxoSmithKline. It belongs to a class of molecules known as peroxisome proliferator-activated receptor delta agonists. Early studies explored its effects on lipid metabolism and energy expenditure in animal models. The compound was never approved as a human medicine, and clinical development was discontinued. In the years since, it has appeared in fitness and bodybuilding communities as a performance-enhancing substance. Regulatory agencies classify it as an unapproved drug.
PPARδ is a nuclear receptor that regulates gene expression related to fatty acid oxidation, glucose homeostasis, and mitochondrial function. GW501516 binds to this receptor with high affinity and activates downstream signaling in skeletal muscle and other tissues. Animal studies reported increased endurance and altered fuel preference, but human data remain limited and inconsistent. The precise relationship between receptor activation and observed physiological changes is still an area of active investigation. Researchers have also examined whether the compound affects inflammation or cell proliferation. No approved therapeutic indication exists for cardarine.
The pharmacological interest in cardarine centers on PPARδ activation and its downstream effects on lipid handling and mitochondrial function. In animal studies, PPARδ agonists have been associated with changes in exercise endurance and fatty acid utilization, though results vary by model and protocol. Human data remain sparse, and the absence of large controlled trials limits conclusions about efficacy. Researchers often describe the compound as a tool for probing PPARδ biology rather than a proven therapeutic agent.
Safety discussions about cardarine frequently cite rodent carcinogenicity findings reported in the 2000s. In those studies, treated animals developed tumors at multiple sites, leading sponsors to discontinue clinical development. The relevance of these findings to humans has not been resolved, but they are a major reason the compound is not approved. Current literature emphasizes uncertainty about long-term effects and the risks of unregulated use. Regulators and health agencies have not established a safe human exposure level.
Cardarine is a synthetic compound also known as GW501516, GW-501516, and sometimes endurobol. It was developed as a selective agonist of peroxisome proliferator-activated receptor delta, a nuclear receptor involved in fatty acid oxidation and energy metabolism. The compound was studied in preclinical models for metabolic and cardiovascular conditions, but it did not become a marketed human medicine. In regulatory and anti-doping contexts, it is treated as a prohibited substance rather than a licensed medicine.
| Property | Value | Notes |
|---|---|---|
| CAS Registry Number | 317318-70-0 | Unique identifier for the compound. |
| Chemical class | PPARδ agonist | Synthetic ligand for peroxisome proliferator-activated receptor delta. |
| Appearance | White to off-white solid | Typical form of research-grade material. |
| Solubility | Soluble in DMSO and ethanol | Poorly soluble in water. |
| Typical storage | -20°C | Recommended for long-term storage of stock solutions. |
Anti-doping laboratories identify GW501516 and its metabolites using liquid chromatography-tandem mass spectrometry. Urine is the usual matrix, and detection can occur after the parent compound has cleared from blood. The exact detection window depends on dose, formulation, individual metabolism, and assay sensitivity. Because the compound is prohibited at all times, athletes are subject to testing in and out of competition. Analytical methods continue to improve as new metabolites and designer analogs are characterized.
GW501516 acts as a ligand for PPAR delta, a nuclear receptor that regulates transcription of genes involved in fatty acid oxidation and energy use. Activation of this receptor in skeletal muscle shifts metabolism toward fat burning in animal models. The compound does not burn fat directly; it changes gene expression over hours to days. Researchers study it to understand metabolic flexibility and exercise adaptation. Effects observed in rodents are not automatically expected in humans.
Anti-doping laboratories identify GW501516 and related metabolites using liquid chromatography coupled with tandem mass spectrometry. Urine is the most common matrix, though blood and dried blood spots may also be analyzed. The method targets the parent compound and phase I and phase II metabolites, which extend the detection window. Because the substance is prohibited at all times, athletes can be tested outside competition. Detection limits and windows depend on the assay, sample type, and individual metabolism.
Cardarine is frequently described as a fat-burning or endurance-enhancing supplement, but these claims exceed the available evidence. The compound is not a hormone, steroid, or selective androgen receptor modulator. Research articles discuss it as a tool compound for studying PPARδ biology, while anti-doping literature focuses on its abuse and detection. Quality of unapproved products is uncertain, and independent analyses have found impurities or incorrect labeling. Open questions include whether human cancer risk resembles that seen in rodents and how often non-athletes use the substance.
Cardarine is a common name for GW501516, a synthetic compound first described in the 1990s as a selective agonist of the peroxisome proliferator-activated receptor delta. It was studied in preclinical models for metabolic and cardiovascular conditions, but it has not been approved as a medicine in the United States, Europe, or other major jurisdictions. Retail products labeled as cardarine are generally research chemicals or supplements, not pharmaceutical formulations. Because human safety and efficacy data remain limited, regulatory agencies treat it as an unapproved substance rather than a therapeutic product.
Sporting authorities added GW501516 to prohibited lists after it appeared in athlete samples and online markets. The World Anti-Doping Agency classifies it as a hormone and metabolic modulator, and its use can lead to an anti-doping rule violation. Some early laboratory work suggested effects on fatty acid oxidation and endurance-related metabolism in animals, but those findings do not establish safe or effective use in people. Reports of adverse events in humans are scarce and often anecdotal, which complicates risk assessment.
PPARδ is a nuclear receptor that influences transcription of genes involved in fatty acid oxidation, lipid transport, and energy homeostasis. GW501516 binds and activates this receptor with high selectivity relative to PPARα and PPARγ in laboratory assays. Activation alters expression of target genes in skeletal muscle, liver, and adipose tissue in animal models. The exact clinical consequences of these changes in humans remain incompletely characterized, and observed effects in animals do not establish therapeutic benefit or safety.
Published studies have examined GW501516 in animal models of obesity, insulin resistance, and exercise endurance. Early human trials reportedly ended, and development was discontinued after preclinical findings raised concerns about cancer in some rodent studies. Regulatory agencies have not approved cardarine for any medical use. Its availability through non-pharmaceutical channels raises questions about identity, purity, and legal status that are separate from its laboratory pharmacology. Those questions are often addressed through analytical testing rather than assumptions about product labels.
Cardarine is a common name for GW501516, also GW-1516, a synthetic compound developed as a peroxisome proliferator-activated receptor delta (PPARδ) agonist. It belongs to a class of agents that modulate gene transcription related to lipid and energy metabolism. The compound was studied in preclinical and early clinical research for metabolic and cardiovascular conditions, but it did not progress to approved therapeutic use. Its name appears in fitness and sports contexts despite not being approved as a drug.
=== Other reactions of biochemical significance === Homocysteine can cyclize to give homocysteine thiolactone, a five-membered heterocycle. Because of this "self-looping" reaction, homocysteine-containing peptides tend to cleave themselves by reactions generating oxidative stress. Homocysteine also acts as an allosteric antagonist at Dopamine D2 receptors. It has been proposed that both homocysteine and its thiolactone may have played a significant role in the appearance of life on the early Earth.
Municipal website Singer, Isidore; et al., eds. (1901–1906). "Jabneh". The Jewish Encyclopedia. New York: Funk & Wagnalls. Yavneh Yields Over a Hundred Philistine Cult Stands Archived 2012-05-31 at the Wayback Machine Biblical Archaeology Review "Jamnia" . Encyclopædia Britannica (11th ed.). 1911. 2008 salvage excavation report, Orit Segal at Excavations and Surveys in Israel, 5 July 2011. Accessed 22 Feb 2017.
=== Air === The European Commission (2000) reports that levels of arsenic in air range 0–1 ng/m3 in remote areas, 0.2–1.5 ng/m3 in rural areas, 0.5–3 ng/m3 in urban areas, and up to about 50 ng/m3 in the vicinity of industrial sites. Based on these data, the European Commission (2000) estimated that in relation to food, cigarette smoking, water, and soil, air contributes less than 1% of total arsenic exposure.
Translation moves the tRNA from the A-site through the P- and E-sites, with the exception of the initiator tRNA, which binds directly to the P-site. Recent experiments have reported that protein translation can also initiate from the A-site. Using toeprinting assay, it has been shown that protein synthesis initiates from the A-site of the ribosome (eukaryotic) in the cricket paralysis virus (CrPV). IGR-IRES (intragenic regions-internal ribosome entry sites) can assemble 80S ribosomes from 40S and 60S ribosomal subunits in the absence of eIF2, Met-tRNAi, or GTP hydrolysis and without a coding triplet in the ribosomal P-site. Authors also showed IGR-IRES can direct translation of a protein whose N-terminal residue is not methionine.
Sources: en.wikipedia.org
A fungarium (plural: fungaria) is a curated collection of preserved fungal specimens and their associated data. Once known as mycological herbaria, these collections provide a permanent record for scientific research. The term was adopted in 2010 to distinguish fungal collections from herbaria (plant collections), in keeping with the modern biological recognition of fungi as a kingdom distinct from plants. Many fungaria are housed within herbaria or other natural history collections, and their holdings may include dried fruiting bodies, host material bearing microscopic fungi, permanent microscope slides, and historically important type specimens. Fungaria developed out of older botanical and mycological collecting traditions and are now found in museums, universities, botanical institutes, and plant-pathology centres. Their specimens are prepared, labelled, stored, and organized so that they can be studied over long periods, and they are commonly accompanied by notes, images, and other documentation. While some collections emphasize large fungi like mushrooms and bracket fungi, others preserve micromycetes (microfungi) alongside their host plants. These preserved specimens differ from living cultures, but researchers often use both to study fungal classification and evolution. These collections are used for tracking environmental changes; by comparing specimens across centuries, researchers can model species shifts and changes in biological timing caused by climate change.
In 2009, Lilly pleaded guilty for illegally marketing antipsychotic medication Zyprexa and agreed to pay a $1.415 billion penalty that included a criminal fine of $515 million, the largest ever in a healthcare case and the largest criminal fine for an individual corporation ever imposed in a US criminal prosecution of any kind at the time. Eli Lilly has faced many lawsuits from people who claimed they developed diabetes or other diseases after taking olanzapine (branded Zyprexa), an antipsychotic medication, as well as by various governmental entities, insurance companies, and others. Internal documents provided to The New York Times revealed that Lilly had downplayed the risks of Zyprexa. According to the documents, 16 percent of people taking Zyprexa gained more than 66 pounds in their first year, a much larger figure than Eli Lilly had shared with doctors. In 2006, Lilly paid $700 million to settle around 8,000 of these lawsuits, and in early 2007, Lilly settled around 18,000 suits for $500 million, which brought the total Lilly had paid to settle suits related to the drug to $1.2 billion. In March 2008, Lilly settled a suit with the state of Alaska, and in October 2008, Lilly agreed to pay $62 million to 32 states and the District of Columbia to settle suits brought under state consumer protection laws. In 2009, four sales representatives for Eli Lilly filed separate qui tam lawsuits against the company for illegally marketing Zyprexa for uses not approved by the Food and Drug Administration.
In humans, EGF has 53 amino acids (sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCzYRDLKWWELR), with a molecular mass of around 6 kDa. It contains three disulfide bridges (Cys6-Cys20, Cys14-Cys31, Cys33-Cys42).
== PEGylated drugs == The attachment of an inert and hydrophilic polymer was first reported around 1970 to extend blood life and control immunogenicity of proteins. Polyethylene glycol was chosen as the polymer. In 1981 Davis and Abuchowski founded Enzon, Inc., which brought three PEGylated drugs to market. Abuchowski later founded and is CEO of Prolong Pharmaceuticals. The clinical value of PEGylation is now well established. ADAGEN (pegademase bovine) manufactured by Enzon Pharmaceuticals, Inc., US was the first PEGylated protein approved by the U.S. Food and Drug Administration (FDA) in March 1990, to enter the market. It is used to treat a form of severe combined immunodeficiency syndrome (ADA-SCID), as an alternative to bone marrow transplantation and enzyme replacement by gene therapy. Since the introduction of ADAGEN, a large number of PEGylated protein and peptide pharmaceuticals have followed and many others are under clinical trial or under development stages. Sales of the two most successful products, Pegasys and Neulasta, exceeded $5 billion in 2011. All commercially available PEGylated pharmaceuticals contain methoxypoly(ethylene glycol) or mPEG. PEGylated pharmaceuticals on the market (in reverse chronology by FDA approval year) have included:
molecules such as antibodies (immunoglobulins), which interact directly with antigens. molecules of the major histocompatibility complex (or MHC), which are expressed on the surface of cells and interact with T cells as part of the adaptive immune response. Sialyl-Lewis X antigen on the surface of leukocytes. H antigen of the ABO blood compatibility antigens. Other examples of glycoproteins include:
Sources: en.wikipedia.org
Collins described her return to the show as "redemption" after withdrawing from her original series, comparing herself to Lara Croft and noted that although the series was tougher this time around, she felt she had "unfinished business" and ultimately "shut it down". She entered camp on the second day of the series alongside Craig Charles, who had also appeared on her original series. Collins completed a helicopter ride into camp, before she and Charles took part in an eating trial, which was won by the latter. She resided in the basic camp "Savannah Scrub" alongside Adam Thomas, Beverley Callard and Seann Walsh for several days, until they joined the main camp after completing a trial in which they were situated in water tanks and had to transport keys to one another. Following her arrival in main camp, Collins fell out of her hammock during one of the episodes. She completed her third trial alongside Scarlett Moffatt, during which time the camp was split into teams. She ultimately lost this trial; however her team the "Rhinos" were victorious and ultimately won a banquet and a trip on safari. Following a safety chain elimination in which Collins was saved by Jimmy Bullard and David Haye was eliminated, Haye then had to choose another campmate to leave alongside him. He chose Collins, who ultimately became the third campmate to be eliminated from the series after spending nine days in camp. Later in the year, Collins is set to begin starring in a Sky One reality series, Gemma Collins: Everything.
=== Diarrhea === Opium tincture is indicated for the treatment of severe fulminant (intense, prolific) diarrhea that does not respond to standard therapy (e.g., Imodium or Lomotil). The usual starting dose is 0.3 mL to 0.6 mL (about six to 12 drops) in a glass of water or juice four times a day. Refractory cases (such as diarrhea resulting from the complications of HIV/AIDS) may require higher than normal dosing, for example, 1 to 2 mL every 3 hours, for a total daily dose of up to 16 mL a day. In terminal diseases, there is no ceiling dose for opium tincture; the dose is increased slowly until diarrhea is controlled.
== References == Aeschliman, M.D (28 March 2005). "Murderous Science". The National Review. Vol. LVII, no. 5. pp. 49–50. Baldwin, Peter (1990). Reworking the Past: Hitler, the Holocaust, and the Historians' Debate. Boston: Beacon Press. Bessel, Richard (August 1990). "Detlev J.K. Peukert". German History. 8 (3): 321–324. doi:10.1093/gh/8.3.321. Crew, David (May 1992). "The Pathologies of Modernity: Detlev Peukert on Germany's Twentieth Century". Social History. 17 (2): 319–328. doi:10.1080/03071029208567840. Kater, Michael (May 1992). "Conflict in Society and Culture: The Challenge of National Socialism". German Studies Review. 15 (2): 289–294. doi:10.2307/1431167. JSTOR 1431167. Kershaw, Ian (2000). The Nazi Dictatorship Problems and Perspectives of Interpretation. London: Arnold Press. ISBN 0-340-76028-1. Lindemann, Albert (February 1982). "Review of Die KPD im Widerstand Verfolgung und Untergrundarbeit am Rhein und Ruhr, 1933-1945". The American Historical Review. 82 (1): 205. doi:10.2307/1863393. JSTOR 1863393. Nolan, Mary (Spring–Summer 1988). "The Historikerstreit and Social History". New German Critique (44): 1–80. Pendas, Devin; Roseman, Mark (2017). Beyond the Racial State: Rethinking Nazi Germany. Cambridge: Cambridge University Press. ISBN 978-1107165458. Peukert, Detlev (1987). Conformity, Opposition and Racism in Everyday Life. New Haven: Yale University Press. ISBN 0300038631. Peukert, Detlev (1994). "The Genesis of the 'Final Solution' from the Spirit of Science". In Thomas Childers; Jane Caplan (eds.). Reevaluating the Third Reich. New York: Holmes & Meier.
== Legal issues == On June 25, 2010, Bayer sued Teva for falsely claiming that Teva's Gianvi was stabilized by betadex as a clathrate, and could consequently be advertised as a generic of Yaz. The settlement resulted in Teva changing its product marketing to remove the claim that it used the same ingredients as Yaz. Bayer's method specifically prevents oxidative degradation of the estrogen, while Teva's does not. In January 2015, the Supreme Court of the United States decided for Teva on the Copaxone patent in Teva Pharmaceuticals USA, Inc. v. Sandoz, Inc. In December 2016, the attorneys general of 20 states filed a civil complaint accusing Teva of a coordinated scheme to artificially maintain high prices for a generic antibiotic and diabetes drug. The complaint alleged price collusion schemes between six pharmaceutical firms including informal gatherings, telephone calls, and text messages. In January 2019, the Supreme Court of the United States decided for Teva in Helsinn Healthcare S.A. v. Teva Pharmaceuticals USA Inc. On May 11, 2019, Teva Pharmaceuticals USA was one of 19 drug companies sued for price fixing in the United States by 44 states for inflating its prices, sometimes up to 1000%, in an illegal agreement among it and its competitors. In June 2021, Teva agreed to pay $925M to settle allegations it had engaged in price fixing in Mississippi. In January 2022, Teva agreed to pay $425M to settle allegations that it had concealed price fixing practices from shareholders. In May 2019, Teva Pharmaceuticals USA agreed to pay $85 million to the U.S.
Sources: en.wikipedia.org
Cardarine is a common name for GW501516, a synthetic PPARδ agonist developed for research. It has not been approved as a medication in any country. It is classified as an unapproved drug and a prohibited substance in sport.
No. Cardarine is not an anabolic steroid; it belongs to a different chemical class that targets PPARδ. Steroids act primarily through androgen receptors, while cardarine acts through a nuclear receptor involved in metabolism.
Some rodent studies reported increased endurance and changes in fat metabolism after cardarine exposure. Long-term studies in animals also raised concerns about cancer in certain tissues. Human trial data are limited, so these findings cannot be directly translated to people.
Cardarine is an investigational synthetic compound that acts as a PPARδ agonist. It is also known as GW501516 and has been studied mainly in preclinical research. It is not an approved medicine.