Nuclear receptor comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Updated 2026-04-08. Numbers and descriptions here follow the published literature rather than marketing material.
Anti-doping laboratories detect GW501516 and its metabolites using liquid chromatography-tandem mass spectrometry. Urine is the most common matrix, though blood and dried blood spots may also be used in some programs. Detection depends on factors such as dose, timing, metabolism, and the sensitivity of the assay. Published methods describe limits of detection in the low nanogram per milliliter range for related compounds. Exact detection windows are not fixed for all situations and remain an area of ongoing study.
Products sold as cardarine have been found to contain incorrect compounds, variable amounts, or no active ingredient at all. Independent testing is required to verify identity and purity. Common analytical approaches include high-performance liquid chromatography, mass spectrometry, and nuclear magnetic resonance for structural confirmation. These methods can distinguish GW501516 from related PPAR agonists and from unrelated steroids. For regulators and researchers, such verification is central to interpreting both biological results and adverse event reports.
Cardarine is prohibited in competitive sport under the World Anti-Doping Agency code, where it is classified as a metabolic modulator. It is not approved as a prescription medicine in the United States, European Union, or other major markets. Regulatory action has focused on its presence in sports and in products marketed as research chemicals. Because it has no accepted medical indication, supply is often unregulated. This status creates legal and safety uncertainties for anyone who encounters the substance.
A persistent misconception is that cardarine is a fat-burning drug or a safe alternative to anabolic steroids. No approved therapeutic product exists, and human safety data are limited. The tumor findings in rodents remain a central concern in scientific reviews. Products sold online may contain inaccurate labels, impurities, or different compounds entirely, which complicates any assessment of effects. Independent testing of such products has reported frequent mislabeling. For these reasons, discussions in the literature emphasize risks and unknowns rather than benefits.
Cardarine is not approved for human therapeutic use in any major jurisdiction. It appears on the World Anti-Doping Agency Prohibited List as a PPARδ agonist within the hormone and metabolic modulators category. Sports organizations test for it because it has been detected in athlete samples and seized products. Regulatory actions against marketed research chemical versions have occurred in several countries, though enforcement varies. Availability through unregulated channels complicates oversight.
Analytical laboratories typically identify cardarine and its metabolites using liquid chromatography-tandem mass spectrometry. Urine is a common matrix in anti-doping testing, while blood and tissue may be used in research settings. Detection windows depend on the assay, the sample matrix, and the compound's metabolism. Because cardarine is extensively metabolized, laboratories often target specific metabolites to improve sensitivity and confirmation. Reference standards are required for reliable quantification. Method validation includes checks for selectivity, linearity, and carryover.
| Property | Value | Notes |
|---|---|---|
| Regulatory status | Prohibited in sport | Listed by WADA as a metabolic modulator. |
| Approved medical use | None in major jurisdictions | Not a registered drug. |
| Common test matrix | Urine | Most anti-doping samples use urine. |
| Typical detection method | LC-MS/MS | Detects parent compound and metabolites. |
| Reference standard storage | -20 °C, desiccated | Typical for analytical standards. |
Detection of GW501516 in biological samples generally relies on liquid chromatography coupled with tandem mass spectrometry. Urine is a common matrix in anti-doping analysis, while blood or plasma may be used in research settings. Sample preparation can involve enzymatic hydrolysis, protein precipitation, or solid-phase extraction before instrumental analysis. Because the compound undergoes metabolism, assays may target the parent molecule, one or more metabolites, or both. Detection windows are not fixed; they depend on factors such as dose, route, individual metabolism, and assay sensitivity. Reference standards are required for accurate identification and quantification.
Handling and quality assessment of cardarine reference material follow general laboratory practices for poorly characterized compounds. It typically appears as a white to off-white powder and is sparingly soluble in water but soluble in organic solvents such as dimethyl sulfoxide and ethanol. Storage recommendations usually specify a cool, dry, dark place, with long-term storage at low temperature and desiccation. Purity may be checked by high-performance liquid chromatography with ultraviolet detection, while identity is confirmed by mass spectrometry and nuclear magnetic resonance. No pharmacopeial monograph exists, so reported purity and stability depend on the supplier’s methods.
Cardarine is explicitly prohibited by the World Anti-Doping Agency under the class of PPARδ agonists. Its presence in urine or blood samples can be detected using mass spectrometry-based methods, often liquid chromatography-tandem mass spectrometry. Athletes who test positive may face sanctions, including bans from competition. The compound is also regulated as a prescription-only or unapproved drug in many countries. Enforcement varies by jurisdiction, and some regions treat it as a controlled substance. Online sales may occur despite these restrictions, creating quality and legal risks.
Laboratory detection of cardarine typically involves sample preparation followed by chromatographic separation and mass spectrometric identification. Urine is the most common matrix for anti-doping tests, though blood and hair have also been explored. Methods can target the parent compound or its metabolites, depending on the expected window of detection. Reference standards are required for accurate quantification. Matrix effects and dilution can influence results, so laboratories use internal standards and validation protocols. The exact detection window varies with dose, route, and individual metabolism.
Cardarine is a common name for GW501516, also GW-1516, a synthetic compound developed as a peroxisome proliferator-activated receptor delta (PPARδ) agonist. It belongs to a class of agents that modulate gene transcription related to lipid and energy metabolism. The compound was studied in preclinical and early clinical research for metabolic and cardiovascular conditions, but it did not progress to approved therapeutic use. Its name appears in fitness and sports contexts despite not being approved as a drug.
PPARδ is a nuclear receptor that influences transcription of genes involved in fatty acid oxidation, lipid transport, and energy homeostasis. GW501516 binds and activates this receptor with high selectivity relative to PPARα and PPARγ in laboratory assays. Activation alters expression of target genes in skeletal muscle, liver, and adipose tissue in animal models. The exact clinical consequences of these changes in humans remain incompletely characterized, and observed effects in animals do not establish therapeutic benefit or safety.
Published studies have examined GW501516 in animal models of obesity, insulin resistance, and exercise endurance. Early human trials reportedly ended, and development was discontinued after preclinical findings raised concerns about cancer in some rodent studies. Regulatory agencies have not approved cardarine for any medical use. Its availability through non-pharmaceutical channels raises questions about identity, purity, and legal status that are separate from its laboratory pharmacology. Those questions are often addressed through analytical testing rather than assumptions about product labels.
== Applications == Synthetic antibodies have shown their utility in a number of applications. Their use within the field of research lies predominantly in the life sciences as reagents for protein capture and as protein inhibitors. Within diagnostics they have been utilised in applications ranging from infection and cancer screening to mycotoxin detection in grain samples. Synthetic antibodies are currently the fastest growing class of therapeutics.
=== Antibacterial Activity === Guanacastepene A has been identified as a potent active ingredient against a wide range of pathogens, with a particular focus on its efficacy against highly resistant clinical isolates. In screening tests, such as the agar diffusion method and the microbroth dilution method, the susceptibility of microorganisms to the active compound Guanacastepene A was determined. In the agar diffusion method, efficacy was assessed by the formation of growth inhibition zones on the solid medium of the test plates. The results indicate that Guanacastepene A exhibits moderate activity against Gram-positive bacteria and poor to low activity against Gram-negative bacteria. In another agar diffusion test, Guanacastepene A produced an inhibition zone against MRSA; particularly noteworthy is its activity against vancomycin-resistant enterococci (VRE/VREF), against which conventional antibiotics such as vancomycin are ineffective. Using the microbroth dilution method, a minimum inhibitory concentration (MIC) of 62.5 µg/ml was determined for a specific test strain (E. coli imp). In this regard, mechanistic studies on Escherichia coli demonstrate that Guanacastepene A has a bactericidal effect. Thus, the active compound not only inhibits growth (bacteriostatic) but actually leads to the death of bacterial cells.
=== Transdermal patch === Transdermal patches can be a very precise time released method of delivering a drug. Cutting a patch in half might affect the dose delivered. The release of the active component from a transdermal delivery system (patch) may be controlled by diffusion through the adhesive which covers the whole patch, by diffusion through a membrane which may only have adhesive on the patch rim or drug release may be controlled by release from a polymer matrix. Cutting a patch might cause rapid dehydration of the base of the medicine and affect the rate of diffusion.
=== Medicinal === For the Nuba tribe of Sudan, scars can serve a medicinal purpose; scars above the eyes are believed to improve eyesight, and scars on the temples are believed to help relieve headaches. In some cultures, scarification is used in traditional medicine to treat some illness by inserting medicine (usually herbs or powdered root) under the skin to heal a variety of infections and illnesses such as Malaria.
Douglas Hart – bass (1984–1991) Murray Dalglish – drums (1984) Bobby Gillespie – drums (1984–1986, 2017) John Moore – rhythm guitar (1986–1987, 2012), drums (1985–1986) Martin Hewes – drums (1986) James Pinker – drums (1986) Dave Evans – rhythm guitar (1987–1989) Richard Thomas – drums (1988–1990) Ben Lurie – rhythm guitar, bass, organ (1989–1998) Steve Monti – drums (1990–1995) Matthew Parkin – bass (1992) Barry Blackler – drums (1992) Nick Sanderson – drums (1993–1998; died 2008) Lincoln Fong – bass (1994–1995) Geoff Donkin – drums (1998) Phil King – bass, rhythm guitar (1998, 2007–2015) Loz Colbert – drums (2007–2008) Brian Young – drums (2012–2021)
Sources: en.wikipedia.org
English is the official language of Belize, a legacy of its former status as a British colony. Belize is the only country in Central America with English as the official language. English is the primary language of public education, government, and most media outlets. Although English is widely used, Belizean Creole is spoken in several situations, whether informal, formal, social, or interethnic dialogue, even in meetings of the House of Representatives. When a creole language exists alongside its lexifier language, as is the case in Belize, a continuum forms between the creole and the lexifier language. Approximately 52.9% of Belizeans self-identify as Mestizo or Hispanic. When Belize was a British colony, Spanish was banned in schools, but since then it has become widely spoken. "Kitchen Spanish" is an intermediate form of Spanish mixed with Belize Creole, spoken in the northern districts. Some good examples are Corozal and San Pedro. Over half the population is multilingual, owing to Belize's status as a small, multiethnic state, surrounded by Spanish-speaking nations. Belize is also home to three Mayan languages: Q'eqchi', Mopan (an endangered language), and Yucatec Maya. Approximately 7,481 people speak the Arawakan-based Garifuna language, and in the mid-1990s about 6,900 Mennonites in Belize spoke Plautdietsch while a minority of Mennonites spoke Pennsylvania Dutch.
Other scientists have stated that this allegation of venom glands "has had the effect of underestimating the variety of complex roles played by oral secretions in the biology of reptiles, produced a very narrow view of oral secretions and resulted in misinterpretation of reptilian evolution". According to these scientists "reptilian oral secretions contribute to many biological roles other than to quickly dispatch prey". These researchers concluded, "Calling all in this clade venomous implies an overall potential danger that does not exist, misleads in the assessment of medical risks, and confuses the biological assessment of squamate biochemical systems." Evolutionary biologist Schwenk says that even if the lizards have venom-like proteins in their mouths they may be using them for a different function, and he doubts venom is necessary to explain the effect of a Komodo dragon bite, arguing that shock and blood loss are the primary factors. Although the mouths of Komodo dragons have been confirmed to contain venom glands with venom in them, it is not clear whether this venom has any serious effect on prey, as opposed to the damage caused by the bite itself. As of 2023, no clear unambiguous evidence of Komodo dragon bites having serious venom effects has been presented. A 2025 histochemical characterisation of the venom glands of the Komodo dragon confirmed the presence of several types of toxins, though the authors note that a venom depositing and draining structure has yet to be identified in lizard teeth, and stress that their study is restricted by specimen availability.
== Transport == The two paralogous enzymes- transmembrane CD38 and GPI anchored CD157, that produce NAADP (and cADPR) in humans both have their active synthesis site in the ectodomain. Though this may involve vesicular synthesis but it has been shown that it is produced at the extracellular sites, and also can act when produced by a different cell or added artificially from outside. So the NAADP has to enter the cell either by diffusion or by transport. Considering the fact that the substrate of NAADP synthesis (NADP) itself is very sparse in the extracellular medium, a purse diffusion based mechanism has been suspected to be less likely than a transporter mediated path. This is compatible with recent data which indicate a carrier mediated transport partially blockable by dipyridamole and cold temperature.
ALFA-tag, a de novo designed helical peptide tag (SRLEEELRRRLTE) for biochemical and microscopy applications. The tag is recognized by a repertoire of single-domain antibodies AviTag, a peptide allowing biotinylation by the enzyme BirA and so the protein can be isolated by streptavidin (GLNDIFEAQKIEWHE) EPEA-tag, commercially called CaptureSelect C-tag, a 4 AA peptide that is recognized by a VHH or single-domain camelid antibody which was discovered through phage display (EPEA) Calmodulin-tag, a peptide bound by the protein calmodulin (KRRWKKNFIAVSAANRFKKISSSGAL) iCapTag™ (intein Capture Tag), a self-removing peptide-based tag (MIKIATRKYLGKQNVYGIGVERDHNFALKNGFIAHN). The iCapTag™ is controlled by pH change. Typically the pH change occurs from pH 8.5 to pH 6.2 and causes release of tagless target-protein to eluent. If needed the pH shift and buffers can be optimized for protein-specific purification method (e.g., for membrane proteins detergent could be added to the buffers to increase solubility of the protein). In contrast to other protein purification methods, this method is not relaying on proteases to cleave off a tag from tag-protein complex. Instead, during elution phase since buffer pH is changed from 8.5 to pH 6.2 that triggers cleavage reaction resulting in a release of tagless target protein while highly engineered tag stays attached to the column. The expected purity of tagless target proteins or peptides is between 95-99%. The iCapTag™ contains patented component derived from Nostoc punctiforme (Npu) intein.
Sources: en.wikipedia.org
Legal status varies by country, but cardarine is not approved as a medicine in major jurisdictions. It is often sold as a research chemical, a category that may not be lawful for human use. Buyers should check local laws and product labels carefully.
Anti-doping laboratories use LC-MS/MS to detect GW501516 and its metabolites, usually in urine. The method can identify the parent compound at low concentrations. Detection windows vary with dose and individual factors.
No, cardarine has no approved medical uses in major jurisdictions. Early research explored metabolic conditions, but those programs were discontinued. It is not a registered treatment for any disease.
No. Cardarine has not received approval for human therapeutic use in major jurisdictions. It remains an investigational compound.