If you have been reading about research chemical and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2025-09-09. Numbers and descriptions here follow the published literature rather than marketing material.
Published studies have examined GW501516 in animal models of obesity, insulin resistance, and exercise endurance. Early human trials reportedly ended, and development was discontinued after preclinical findings raised concerns about cancer in some rodent studies. Regulatory agencies have not approved cardarine for any medical use. Its availability through non-pharmaceutical channels raises questions about identity, purity, and legal status that are separate from its laboratory pharmacology. Those questions are often addressed through analytical testing rather than assumptions about product labels.
Cardarine is a common name for GW501516, also GW-1516, a synthetic compound developed as a peroxisome proliferator-activated receptor delta (PPARδ) agonist. It belongs to a class of agents that modulate gene transcription related to lipid and energy metabolism. The compound was studied in preclinical and early clinical research for metabolic and cardiovascular conditions, but it did not progress to approved therapeutic use. Its name appears in fitness and sports contexts despite not being approved as a drug.
At the molecular level, GW501516 binds and activates PPARδ, a nuclear receptor that regulates transcription. Activation shifts expression of genes involved in fatty acid oxidation, energy expenditure, and lipid transport in skeletal muscle and liver. Animal studies report increased endurance and altered lipid profiles after exposure. Human data are limited to small trials and do not establish long-term safety or efficacy. PPARδ also has roles in cell proliferation, so the relationship between activation and cancer risk remains an open question.
Published literature on cardarine includes in vitro assays, rodent experiments, and a small number of human studies. Reports describe effects on exercise capacity and lipid metabolism in animals, while human evidence is sparse. Many online descriptions present the compound as a proven endurance aid, a claim not supported by regulatory approval or large clinical trials. Analytical studies focus on identifying the parent compound and its metabolites in biological samples. Important uncertainties include species differences, dose-response relationships, and the relevance of rodent tumor findings to humans.
| Property | Value | Notes |
|---|---|---|
| Chemical class | PPARδ agonist | Not an anabolic steroid. |
| Common synonyms | GW501516, GW-1516 | Cardarine is an informal name. |
| Appearance | White to off-white powder | Typical for research-grade solid. |
| Solubility class | Poorly soluble in water; soluble in some organic solvents | Such as DMSO or ethanol in laboratory settings. |
| Typical storage temperature | Cool, dry, protected from light | Specific conditions vary by supplier and form. |
In laboratory settings, cardarine is studied as a tool compound for probing PPARδ biology. Published experiments often use cell cultures, rodent models, or isolated tissues. Some investigations focus on metabolic effects, while others assess potential risks such as carcinogenicity observed in long-term animal studies. Because human trials are sparse, most knowledge comes from preclinical work and adverse event reports. Scientific literature frequently notes the gap between animal findings and human outcomes. The compound is not a dietary supplement and is not intended for human consumption.
Cardarine is a common name for GW501516, a synthetic compound developed in the 1990s through research collaborations involving GlaxoSmithKline. It belongs to a class of molecules known as peroxisome proliferator-activated receptor delta agonists. Early studies explored its effects on lipid metabolism and energy expenditure in animal models. The compound was never approved as a human medicine, and clinical development was discontinued. In the years since, it has appeared in fitness and bodybuilding communities as a performance-enhancing substance. Regulatory agencies classify it as an unapproved drug.
Clinical development stopped after rodent studies showed tumors at multiple sites. Whether those findings predict human cancer risk remains an open question, but they led sponsors to discontinue programs. Human safety data are limited to small, short-term studies that were not designed to assess cancer risk. Reported effects in those studies included changes in blood lipids, but the evidence is insufficient for medical use. Long-term consequences of nonmedical use are not well characterized. Questions about dose, duration, and individual susceptibility remain unresolved.
Cardarine is a common name for GW501516, an investigational compound developed in the 1990s for metabolic conditions. It acts as an agonist at peroxisome proliferator-activated receptor delta, a nuclear receptor involved in lipid and energy metabolism. The compound is frequently mislabeled as a selective androgen receptor modulator, or SARM, but its molecular target is different. GW501516 reached early clinical testing before development was discontinued. It has no approved therapeutic use in any country. The name cardarine is not a formal international nonproprietary name.
== Structure == It was part of the organizational structure of the Ethiopian regular army as one of the 4 divisions that comprised the regular army. The Ethiopian Imperial Host included the 40,000 men and women of the Regular Army and the approximately 100,000 men and women of the National Guard/Biherawi Tor/. The 1st Division or Kebur Zabagna (as it was later reconstituted under Emperor Haile Selassie) was based at Addis Ababa. It was divided into 4 battalions with the 2nd battalion charged with its primary tasking, protection of the person of the Emperor. The 2nd Battalion had an infantry and cavalry regiment based out of Menelik and Jubilee Palaces as well as the soccer stadium in the Lagare area. The other 3 battalions incorporated its marching band, an elite airborne regiment Berari Neber or flying tigers, a medical corps and staff of its own hospital and a headquarters corps. It roughly numbered about 10,000 during the reign of Haile Selassie I.
== Properties and reactions == Unlike sodium carbonate, which forms at least three hydrates, lithium carbonate exists only in the anhydrous form. Its solubility in water is low relative to other lithium salts. The isolation of lithium from aqueous extracts of lithium ores capitalizes on this poor solubility. Its apparent solubility increases 10-fold under a mild pressure of carbon dioxide; this effect is due to the formation of the metastable lithium bicarbonate, which is more soluble:
In 1953, WNAO-TV, channel 28, became the city's first television station, though it folded in 1957. Raleigh experienced significant damage from Hurricane Hazel in 1954. With the opening of the Research Triangle Park in 1959, Raleigh began to experience a population increase, resulting in a total city population of 100,000 by 1960. In 1960, the Census Bureau reported Raleigh's population as 76.4% White and 23.4% Black. Following the passage of the federal Voting Rights Act of 1965, one of the main achievements of the Civil Rights Movement and the Lyndon B. Johnson presidency, political participation and voting by African Americans in Raleigh increased rapidly. From the early to mid-20th century, East Hargett Street was known as Raleigh's "Black Main Street" and hosted numerous Black-owned businesses. The area declined after the city desegregated its establishments. Another of Raleigh's oldest Black neighborhoods, Fourth Ward, was demolished starting in 1971, with about 600 homes and 60 businesses south of downtown gone as a result of urban renewal, and 1,600 people forced to move. It was claimed that housing was substandard and the area had a lot of crime. By the early 1970s, people in Raleigh were growing increasingly concerned about growth and urban sprawl. Community organizations felt that municipal offices were being too heavily influenced by business interests when the city's population was rapidly growing and various development projects were being proposed.
=== Research === Hepatitis B and its related disorders are important public health issues in China, which not only presents challenges for doctors and scientists but also increases the burden for the government. Last year, the Chinese Government funded research with around Ɲ3 billion (US$390 million), mainly against hepatitis B and related diseases over the next decade. Research will include: large retrospective and prospective studies of the population vaccinated against hepatitis B and the incidence of HCC; genetic variation in HBV and its subtypes, and mutations in HBV DNA in the response to interferon and nucleotide analogues; host-gene variation and the therapeutic response, including single-nuclear polymorphisms and gene copy-number variations; virus mutation and the mechanism of the immune response in fulminant liver failure, and the immunological factors which cause liver injury and the markers which predict reduction in liver function; assessment and prediction of liver fibrosis by non-invasive biomarkers, and interference with fibrosis from small chemical compounds or traditional Chinese medicines; prediction of the development, metastasis, and prognosis of HCC by molecular typing; and the identification of important signal transduction pathways in HCC and the development of new small chemical compounds to target HCC.
Sources: en.wikipedia.org
=== Middle Eastern countries === As of March 2026, Nando's has five restaurants in Bahrain; two in Manama and one each in Amwaj Islands, Isa Town and Saar. In Qatar, Nando's has been established since 2001, with the first restaurant located on Salwa Road. As of October 2022, Nando's has eight branches in Qatar, seven of which are located in Doha while one is in Al Wakrah. In Saudi Arabia, Nando's opened its first restaurant within the country on 12 December 2016 in Riyadh, and opened its first branch in Jeddah on 8 December 2018 As of March 2026, Nando's has nine branches in Saudi Arabia; three in Riyadh, three in Jeddah; and one each in Dhahran, Dammam and Khobar. Nando's opened its first restaurant within the United Arab Emirates in Dubai (along Sheikh Zayed Road) in 2002 and opened its first branch in Abu Dhabi in 2014. As of August 2021, Nando's has 19 branches in the UAE; 13 in Dubai, three in Abu Dhabi and one each in Sharjah, Al Ain and Ras Al Khaimah. As a former market, Israel was home to a successful Nando's franchise network throughout the 1990s and 2000s, with the Israeli operation involving the Brozin brothers alongside the international Nando's business. The first Israeli branch opened in Herzliya in 1993, and by 1996 there were branches in Tel Aviv, Herzliya and Haifa, with plans for further expansion. By March 2004, the network had grown to 15 restaurants. In December 2005, Nando's Israel was acquired by Israeli businessman Yuval Doron's Eddy Global Holdings. Kenny Brozin remained chief executive of the Israeli operation until June 2006.
=== Lithuanian === Association of Lithuanian Workers - Founded in 1930. In 1972 the Association had 100 locals. By 1979 this had dropped to 80. In 1965 the ALW had 4,555; this dropped to 1,000 in 8 states in 1979. In 1994 it had 1,800 members. Headquarters in Ozone Park, Queens. National convention meets biennially. Women's groups called "sororities", carried out the group's charity work. Conducts "fraternal social and cultural activities" including three scholarships per year for its members. Lithuanian Alliance of America - The idea for forming this society first came up in the Lietuwiszka Gazieta of New York on August 16, 1879. The constituting convention was held in Plymouth, Pennsylvania, on November 22, 1886, from Polish and Lithuanian parish societies. Originally meant to be a joint Polish-Lithuanian society, but after "heated discussion" the convention decided that American Lithuanians were "badly in need of de-Polonized churches". In the early 1900s, there was tension between the lay and the clergy leading to the split of the Lithuanian Socialist Federation. Communist sympathizers within the group revolted in 1920, and there was a warning against Communist infiltration in 1925; "progressives" also apparently disrupted many lodges and brought litigation in the 1930s. Headquartered in New York. National convention meets biennially. Had 12,492 members in 303 lodges and 425 in the Juvenile Department in 1923. 22,332 members in 332 lodges throughout 24 states. Had 270 lodges in 1972 and 209 lodges in 1979 with 6,563 members. Had 5,000 in 1994.
== Description == It is a perennial, with a typical growth height of 50–120 cm. Like most other members of the carrot family, it produces large umbels of white flowers and has dissected leaves. Angelica keiskei closely resembles Angelica japonica, but can be distinguished by its blooming period, which lasts from May to October, whereas A. japonica's blooming period lasts only between May and July. Another indicator is the characteristic color of its sap.
He also appeared on special episodes, like Raw's 25th anniversary episode, Raw Reunion, In 2022, Austin had his first feud since his retirement with Kevin Owens. At WrestleMania 38, Austin defeated Owens in a No Holds Barred match, his first match in 19 years.
Huang for a method to produce graphene-based on exfoliation followed by attrition. In 2014, inventor Larry Fullerton patented a process for producing single-layer graphene sheets by graphene's strong diamagnetic properties.
Sources: en.wikipedia.org
== Description == Small clump-forming from a robust, somewhat woody rootstock with erect, hispid, unbranched stems 25–40 cm (9.8–15.7 in) high. Basal leaves linear elliptic to narrowly lanceolate, 10–15 cm (3.9–5.9 in) long with stalks to 4 cm (1.6 in); stem leaves smaller and sessile, velvety-hairy. Flowers are yellow, 3.5–4.5 cm (1.4–1.8 in) long by 1.2–1.6 cm (0.5–0.6 in) across densely planted on the ends of stems and branches. It flowers from early to late summer. All aerial parts are pubescent.
The clipper sailing ship Dunedin, owned by the New Zealand and Australian Land Company (NZALC), was refitted in 1881 with a Bell-Coleman compression refrigeration machine. This freezer unit worked by compressing air, then releasing it into the hold of the ship. The expanding air absorbed heat as it expanded, cooling the cargo in the hold. Burning three tons of coal a day in the steam engine that ran the compressor, it could lower the temperature of the hold by 40 °F (22 °C) compared to the surrounding air temperature, which froze the cargo in the temperate climate of southern New Zealand and then maintained it below freezing (32 °F, 0 °C) through the tropics. Dunedin's most visible sign of being an unusual ship was the funnel for the refrigeration plant placed between her fore and main masts (sometimes leading her to be mistaken for a steamship which had been common since the 1840s). In February 1882, Dunedin sailed from Port Chalmers, New Zealand, with 4,331 mutton, 598 lamb and 22 pig carcasses, 246 kegs of butter, and hare, pheasant, turkey, chicken and 2,226 sheep tongues. It arrived in London after sailing 98 days with its cargo still frozen. After meeting all costs, the NZALC company made a £4,700 profit from the voyage. Soon after Dunedin's successful voyage, an extensive frozen meat trade from New Zealand and Australia to the UK was developed with over 16 different refrigerated and passenger refrigerated ships built or refitted by 1900 in Scotland and Northern England shipyards for this trade.
=== Osteoinduction === Osteoinduction involves the stimulation of osteoprogenitor cells to differentiate into osteoblasts that then begin new bone formation. The most widely studied type of osteoinductive cell mediators is bone morphogenetic proteins (BMPs). A bone graft material that is osteoconductive and osteoinductive will not only serve as a scaffold for currently existing osteoblasts but will also trigger the formation of new osteoblasts, theoretically promoting faster integration of the graft.
Some courtroom observers during the first trial described Letby as "aloof and indifferent" and noted her frequent claims of having no recollection of events, which they felt contributed to an impression of guilt.
In humans, EGF has 53 amino acids (sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCzYRDLKWWELR), with a molecular mass of around 6 kDa. It contains three disulfide bridges (Cys6-Cys20, Cys14-Cys31, Cys33-Cys42).
Sources: en.wikipedia.org
Cardarine is commonly known as GW501516 or GW-1516. These names refer to the same synthetic compound. It is not a brand-name approved medicine.
No, cardarine is not a steroid. It is classified as a PPARδ agonist. Its structure and receptor target differ from anabolic steroids.
No regulatory agency has approved cardarine as a medicine. It was investigated in early research but development was discontinued. It is not available as a prescription drug.
Cardarine is a common name for the investigational compound GW501516. It acts as a PPARδ agonist and is not approved for human use. It is prohibited in sport.