A practical reference on research chemical: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
This page was last updated on 2026-03-02 and is reviewed periodically as new material appears.
GW501516 acts as an agonist at the peroxisome proliferator-activated receptor delta, a nuclear receptor that regulates gene expression. Activation shifts transcription toward genes involved in fatty acid uptake, oxidation, and energy expenditure. The compound does not bind the androgen receptor and therefore differs from anabolic steroids and SARMs. In rodent models, this metabolic shift has been linked to increased running endurance and reduced fat accumulation. The exact downstream pathways in humans remain incompletely characterized.
Early clinical research explored GW501516 for lipid disorders, obesity, and diabetes. Some short-term human studies reported changes in HDL cholesterol, LDL cholesterol, and triglycerides. The development program was discontinued after rodent studies showed dose-dependent tumor formation in multiple tissues, including liver, bladder, stomach, and skin. These findings raised concerns about long-term cancer risk in humans. Because human exposure data are limited, the clinical significance of the rodent tumors remains uncertain.
Literature on cardarine often separates receptor pharmacology from toxicology. Mechanistic papers describe PPARδ activation and gene expression changes, while safety assessments focus on carcinogenicity and species differences. Questions remain about whether rodent tumors arise through PPARδ-dependent or off-target mechanisms. Another open area is how human metabolism and exposure compare with those in animal studies. Analytical methods such as liquid chromatography–mass spectrometry are used to confirm identity in biological and product samples.
Laboratory detection of cardarine typically involves sample preparation followed by chromatographic separation and mass spectrometric identification. Urine is the most common matrix for anti-doping tests, though blood and hair have also been explored. Methods can target the parent compound or its metabolites, depending on the expected window of detection. Reference standards are required for accurate quantification. Matrix effects and dilution can influence results, so laboratories use internal standards and validation protocols. The exact detection window varies with dose, route, and individual metabolism.
A common misconception is that cardarine has been proven safe for human use. In reality, human clinical data are limited, and long-term animal studies have raised concerns about cancer. Another misconception is that it is a supplement or vitamin-like compound. It is a synthetic research chemical with no approved medical indication. Scientific discussion often focuses on its mechanism and detection rather than therapeutic use. Regulatory and anti-doping literature treats it primarily as a prohibited substance.
Cardarine is explicitly prohibited by the World Anti-Doping Agency under the class of PPARδ agonists. Its presence in urine or blood samples can be detected using mass spectrometry-based methods, often liquid chromatography-tandem mass spectrometry. Athletes who test positive may face sanctions, including bans from competition. The compound is also regulated as a prescription-only or unapproved drug in many countries. Enforcement varies by jurisdiction, and some regions treat it as a controlled substance. Online sales may occur despite these restrictions, creating quality and legal risks.
| Property | Value | Notes |
|---|---|---|
| Primary target | PPARδ | Nuclear receptor; not androgen receptor |
| Studied indications | Dyslipidemia; obesity; diabetes | Early clinical research; development discontinued |
| Rodent toxicity | Tumor formation in multiple tissues | Dose-dependent findings in some studies |
| Human approval | None | No approved therapeutic use |
| Typical analytical method | LC-MS/MS | Used for identity and quantification |
Cardarine is the common name for GW501516, a synthetic compound studied as a peroxisome proliferator-activated receptor delta agonist. Researchers developed it to explore treatments for lipid disorders and metabolic conditions. It is not an approved medicine in any country. Early clinical work examined changes in HDL cholesterol and triglycerides, but development was discontinued after animal studies raised concerns about cancer. The compound remains available as a research chemical and appears in discussions of performance enhancement.
At the molecular level, GW501516 binds and activates PPARδ, a nuclear receptor that regulates transcription. Activation shifts expression of genes involved in fatty acid oxidation, energy expenditure, and lipid transport in skeletal muscle and liver. Animal studies report increased endurance and altered lipid profiles after exposure. Human data are limited to small trials and do not establish long-term safety or efficacy. PPARδ also has roles in cell proliferation, so the relationship between activation and cancer risk remains an open question.
Published literature on cardarine includes in vitro assays, rodent experiments, and a small number of human studies. Reports describe effects on exercise capacity and lipid metabolism in animals, while human evidence is sparse. Many online descriptions present the compound as a proven endurance aid, a claim not supported by regulatory approval or large clinical trials. Analytical studies focus on identifying the parent compound and its metabolites in biological samples. Important uncertainties include species differences, dose-response relationships, and the relevance of rodent tumor findings to humans.
GW501516 acts as an agonist at peroxisome proliferator-activated receptor delta, a nuclear receptor involved in transcription of genes related to lipid handling and energy use. Activation of PPARδ can shift skeletal muscle toward greater fatty acid oxidation in animal models, which is one reason it drew interest for metabolic disease and exercise research. The exact downstream effects depend on tissue, species, dose, and duration. Human data are sparse, so many proposed benefits remain hypotheses rather than established clinical outcomes.
Laboratory studies have examined GW501516 in cell cultures and rodents for conditions such as dyslipidemia, insulin resistance, and obesity. Some trials in humans were initiated, but development was discontinued after preclinical findings raised concerns about cancer in certain models. Those findings do not prove that the compound causes cancer in people, but they contributed to regulatory caution. Later reviews often describe the evidence as preliminary and insufficient for assessing long-term safety.
In the fitness and bodybuilding literature, cardarine is frequently discussed as an endurance agent or fat-loss compound, although such claims are not supported by robust clinical evidence. Online descriptions often mix animal data, user anecdotes, and marketing language. Researchers who study PPARδ agonists distinguish between receptor activation in controlled experiments and unsupervised use of unverified products. The latter introduces unknown purity, dose, and interactions, making reported experiences difficult to interpret scientifically.
In May 2021, Freddy's hired Chris Dull as CEO to take over the top post from co-founder Randy Simon. In August 2022, Freddy's hired Brian Wise as COO to take over the operations post from co-founder Scott Redler. In November 2022, the company signed a master franchise and development agreement that will allow the brand to expand into Canada by 2025, opening restaurants in nine provinces. In August 2025, Rhône Group agreed to acquire Freddy's from Thompson Street Capital Partners, who acquired the brand in 2021, for an enterprise value of around $700 million. The acquisition was finalized in September 2025.
=== Preclinical === AB-300 (AB300) – non-hallucinogenic serotonin 5-HT2A and 5-HT2C receptor agonist AB-5006 (AX-5006) – Escherichia coli csgA protein aggregation inhibitor and gastrointestinal microbiome modulator [96] AEX-23 – orexin OX1 receptor agonist and α-synuclein aggregate/modulator [97] Afamelanotide ([Nle4,DPhe7]-α-MSH; CUV-1647; EPT-1647; Melanotan I; Melanotan; MT-I; Prenumbra; Scenesse) – melanocortin receptor agonist [98] Alpha-synuclein aggregation inhibitor (ACI-5755; morphomer α-synuclein) – α-synuclein inhibitor [99] BEBT-758 – RNA interference and α-synuclein expression inhibitor [100] Bevemipretide (SBT-272) – cardiolipin ligand and stabilizer [101] BSC-3301 – receptor-interacting serine/threonine-protein kinase 1 (RIPK1) inhibitor [102] BXQ-350 (SapC; SapC-DOPS; sphingolipid activator protein C) – sphingomyelin phosphodiesterase stimulant and sphingosine 1-phosphate stimulant [103] Cannabidiol (CBD) – cannabinoid receptor modulator and other actions [104] Carbon monoxide (CO; HBI-002) – heme oxygenase 1 modulator [105] CB-401 – amyloid β-protein modulator [106] CBT-102 – undefined mechanism of action [107] CJRB-301 (MRx-0005) – bacteria replacement and microbiome modulator [108] CJRB-302 (MRx-0029) – bacteria replacement and microbiome modulator [109] CK-0803 – regulatory T-lymphocyte replacement [110] CU-13001 – 15-lipoxygenase (15-LOX/ALOX15) inhibitor [111] EHP-102 (VCE-003.2) – cannabinoid CB2 receptor agonist and peroxisome proliferator-activated receptor alpha (PPARα) modulator (cannabigerol (CBG) derivative) [112] Estianeptine ((S)-tianeptine; TNX-4300) – peroxisome proliferator-activated receptor PPARβ/δ and PPARγ agonist [113] FHL-401 – toll-like receptor 2 antagonist [114] FHL-701 – interleukin-12 (IL-12) subunit p40 inhibitor [115] FKK-01PD (FKK-01PD; TGHW-01AP; apomorphine prodrug) – non-selective dopamine receptor agonist and other actions [116] HT-4403 – leucine-rich repeat kinase 2 (LRRK2) inhibitor [117] IC-100 (ICCN-100) – various actions [118] KFRX-05 (BK-40195) – leucine-rich repeat kinase 2 (LRRK2) inhibitor and protein tyrosine kinase inhibitor [119] KP-405 – undefined mechanism of action [120] LB-P4 – bacteria replacement and microbiome modulator [121] Mbiotix – bacteria replacement and microbiome modulator [122] ML-021 – muscarinic acetylcholine M4 receptor antagonist [123] MP-201 – 2,4-dinitrophenol (DNP) prodrug and various actions [124] NB-003 – gene transference and parkin protein replacement [125] NB-129 – undefined mechanism of action [126] NLY-02 – glial cell inhibitor [127] NLY-03 – undefined mechanism of action [128] NNI-362 – 70 kDa ribosomal protein S6 kinase modulator [129] NRG-5051 – mitochondrial permeability transition pore inhibitor [130] PMN-442 – monoclonal antibody against α-synuclein [131] PP-003 – α-synuclein degrader [132] Research programme: 3100 programme - DigmBio/Daegu Catholic University – G protein-coupled receptor (GPCR) modulators [133] Research programme: enzyme targeted therapeutics - Nitrase Therapeutics – enzyme modulators and α-synuclein inhibitors [134] Research programme: neurodegenerative disease therapeutics - Caraway Therapeutics – autophagy stimulants and MCOLN1 stimulants [135] RGL-193 – undefined mechanism of action [136] ST-502 – gene therapy and α-synuclein genetic transcription inhibitor [137] Tomaralimab (NM-101; NM-102; NM-103; OPN-305) – monoclonal antibody against toll-like receptor 2 [138] Zervimesine (CT-1812; Elayta) – sigma σ2 receptor antagonist [139]
== Use in agriculture == Plant regulators (PRs) or plant growth regulators (PGRs) are compounds, both naturally occurring and synthetic, used in agriculture to modify the behaviour of plants. They can be used to increase or inhibit growth, influence flowering and/or fruit growth, alter the maturation, or reduce abiotic stress. The compendium of pesticide common names lists 103 plant growth regulators, many of which have been removed from the market. When used in field conditions, plant hormones or mixtures that include them can be applied as biostimulants.
== Treatment == For people with the FOLR1 mutation, even when the systemic deficiency is corrected by folate (the oxidized form - folic acid), the cerebral deficiency remains, and must be treated with folinic acid. Folinic acid is a metabolically active form of folate that can be easily introduced into the folate cycle. A typical dose that is administered to children is 0.5–1 mg/kg daily, but the dose can be increased depending on the severity of symptoms and the age of the child. Over time, the treatment with folinic acid has shown to reduce a variety of symptoms of CFD. The treatment of folinic acid can lead to improvements in walking, speech, interpersonal skills and reduction in seizures. Success depends on early initiation of treatment. Starting the folinic acid treatment before the age of six is more advantageous for the child with CFD. If the treatment is started after the age of six, its results are not as effective. Treatment requires taking folinic acid for lengthy periods. Fewer than 20 people with the FOLR1 defect have been described in the medical literature. Folinic acid (5-formyl-THF, 5-fTHF) also appears useful for some other forms of CFD. Pharmacologic doses of folinic acid has also led to reversal of some symptoms in children diagnosed with cerebral folate deficiency and testing positive for autoantibodies to folate receptor alpha. It also appears useful in DHFR deficiency and AADC deficiency. 5-MTHF (5-methyl-THF) is also available as a drug (levomefolic acid). It is "thought to be the most efficient way to restore CSF 5-MTHF concentrations".
Sources: en.wikipedia.org
== Chemistry == Grammotoxin is a 36 amino acid protein toxin, with the sequence Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val (DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV), and disulfide bridges between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys30. It forms an inhibitor cystine knot motif, common in spider toxins. Its chemical formula is: C177H268N52O50S6 Grammotoxin can be purified from Grammostola spatulata venom by reverse phase high performance liquid chromatography.
== Discovery and name == Taurine was first isolated from ox bile in 1827 by German scientists Friedrich Tiedemann and Leopold Gmelin. Another German scientist Von H. Demarcay first used its common chemical name Taurine in 1838, derived from the Latin taurus (cognate to Ancient Greek ταῦρος, taûros) meaning bull or ox. It was subsequently identified in human bile in 1846 by Edmund Ronalds.
Gaddafi married his first wife, Fatiha al-Nuri, in 1969. They had one son, Muhammad Gaddafi (born 1970); their relationship was strained, and they divorced in 1970. Gaddafi's second wife was Safia Farkash, née el-Brasai, a former nurse from the Obeidat tribe, born in Bayda. They met in 1969, after his ascension to power, when he was hospitalized with appendicitis; he claimed that it was love at first sight. The couple remained married until his death. Together they had seven biological children: Saif al-Islam Gaddafi (1972–2026), Al-Saadi Gaddafi (born 1973), Mutassim Gaddafi (1974–2011), Hannibal Muammar Gaddafi (born 1975), Aisha Gaddafi (born 1976), Saif al-Arab Gaddafi (1982–2011), and Khamis Gaddafi (1983–2011). He also adopted two children, Hana Gaddafi and Milad Gaddafi. Several of his sons gained a reputation for lavish and anti-social behaviour in Libya, which proved a source of resentment toward his administration. At least three of his cousins were prominent figures in Gaddafi's regime. Ahmed Gaddaf al-Dam is Libya's former Special Envoy to Egypt and a leading figure of the Gaddafi regime. Mansour Dhao was his chief of security and led the People's Guard. Sayyid Gaddaf al-Dam was a brigadier general and described as the second most powerful person in Libya in the 1980s. Saif al-Islam Gaddafi, the son who was considered to be Gaddafi's main heir, was assassinated in February 2026.
Sources: en.wikipedia.org
== Cast == Joseph Wairimu as Mwas Olwenya Maina as Oti Nancy Wanjiku Karanja as Amina Mugambi Nthiga as Cedric Paul Ogola as Mose Antony Ndung'u as Waf Johnson Gitau Chege as Kyalo Kamau Ndungu as John Waya Abubakar Mwenda as Dingo Mburu Kimani as Daddy M Mehul Savani as Khanji Maina Joseph as Kimachia Shix Kapienga Jacky Vike as Ruth
where w refers to the water, and l refers to the lipids. While the δD of source water is the biggest influence on the δD of lipids, discrepancies between fractionation factor values obtained from the slope and from the intercept of the regression suggest that the relationship is more complex than a two-pool fractionation. In other words, there are multiple fractionation steps that must be taken into account in understanding the isotopic composition of lipids.
Silent mutations affect protein folding and function. Normally a misfolded protein can be refolded with the help of molecular chaperones. RNA typically produces two common misfolded proteins by tending to fold together and become stuck in different conformations and it has a difficulty singling in on the favored specific tertiary structure because of other competing structures. RNA-binding proteins can assist RNA folding problems, however, when a silent mutation occurs in the mRNA chain, these chaperones do not bind properly to the molecule and are unable to redirect the mRNA into the correct fold. Recent research suggests that silent mutations can have an effect on subsequent protein structure and activity. The timing and rate of protein folding can be altered, which can lead to functional impairments.
Sources: en.wikipedia.org
It targets PPARδ, a nuclear receptor involved in lipid and energy metabolism. It does not act primarily on androgen receptors. This distinction separates it from SARMs.
Rodent studies found dose-dependent tumors in several organs. The sponsor discontinued the program over cancer concerns. Human risk from long-term use remains unknown.
Controlled human endurance trials are lacking. Animal studies show increased exercise capacity under some conditions. Anecdotal reports are not equivalent to clinical evidence.
Yes, WADA prohibits cardarine as a PPARδ agonist. It appears on the prohibited list and can be detected in urine or blood. Athletes using it risk sanctions.